INDIA HERBS - ANCIENT REMEDIES FOR MODERN TIMES
Title
Doctor Approved Ayurveda Formula for Heart Care
HIDE
Home
Testimonials
Ingredients
Phyto Profile
Results
Ayurveda
Faq
Guarantee
Order Now!
Webmasters
Distributor
Newsletter
Video
About Us
Contact
Leading Edge News



Call Us at +1-800-721-6301

  En Français
  In Italiano
  Em Português
  En Español

Holistic Education

vHolistics.com
vHolistics.com/brandnewme


 100% Extracts

DOCTOR
ENDORSED
Our Medical Board
Get a Consultation
Dr. C.D. Raviraj
Dr. Christianne Cabrera
Dr. Meena Shah
Dr. Amit Bhandari

Click here to learn about our 110% Money Back Guarantee.

Click to verify BBB accreditation and to see a BBB report.

See All Products

View our Product Catalog
Or
Download the PDF Version


Also Visit Our Websites for:
Anti Aging
Arthritis
Beauty
Brain Power
Detoxification
Female Arousal
Healthy Blood
Immune Support
Lover's Yoga
Male Potency
Male Virility
Mood Support
Natural Healing
Prostate Care
Sleep Aid
Strength
Weight Loss
Yoga for Virility
 
Share Your Feedback, Questions, and Comments!




Tell Your Friends!


Clinical Studies

Abstracts are presented below for clinical studies on Onion.

  • Botanical Name: Allium Cepa

  • Ayurvedic Name: Palandu

  • Common Name: Onion

Allium Cepa

Plant Phytonutrient Profile


1: Plant J. 2007 Mar;49(5):878/​88.

Glutathione conjugates in the vacuole are degraded by gamma/​glutamyl
transpeptidase GGT3 in Arabidopsis.

Ohkama/​Ohtsu N, Zhao P, Xiang C, Oliver DJ.

Department of Genetics, Development and Cell Biology, Iowa State University,
Ames, IA 50011, USA.

gamma/​Glutamyl transpeptidase (GGT) is the enzyme responsible for breaking the
gamma/​glutamyl bond between Glu and Cys in glutathione (GSH). We are using this
gene family to study GSH degradation in plants. There are four putative GGT
genes in Arabidopsis, and one of them, GGT3 (At4g29210), is analyzed in this
study. GGT3 is localized to the vacuole based on organelle/​targeting programs,
subcellular distribution of GFP fusion proteins during transient expression in
onion (Allium cepa) epidermal tissues, and its ability to metabolize vacuolar
substrates in Arabidopsis plants. While Northern blots and promoter:GUS
expression patterns have suggested that GGT3 is transcribed at relatively high
levels in all parts of the plant, a comparison of enzyme activities in different
organs of wild/​type and a ggt3 knockout mutant showed that GGT3 was a major
contributor to total GGT activity in roots, but a relatively minor contributor
in other tissues. Wild/​type Arabidopsis plants treated with monobromobimane
(mBB) form a fluorescent GSH/​mBB conjugate that is moved into the vacuole and
then metabolized to Cys/​Gly/​mBB and Cys/​mBB in that order. The first step is
catalyzed by GGT3, and GSH/​mBB metabolism is completely blocked in the roots of
ggt3 knockout plants. In ggt3 leaves, some GSH/​mBB metabolism still proceeds
using the apoplastic GGT1. This identifies GGT3 as catalyzing the obligate
initial step in GSH conjugate metabolism, and suggests that it has an important
role in protecting plants from some xenobiotic chemicals.

PMID: 17316176 [PubMed /​ in process]

2: Tsitol Genet. 2006 Nov/​Dec;40(6):50/​8.

[The influence of cadmium and potassium on the level of cytogenetic effects
induced by thorium/​232 in Allium cepa root meristem]

[Article in Russian]

Evseeva TI, Maistrenko TA, Geras'kin SA, Belykh ES.

The influence of different concentrations of cadmium and potassium on the levels
of mutagenic and cytotoxic effects induced by thallium/​232 in Allium cepa root
meristem has been studied. The combined action of 232Th (0.8 microM) with
cadmium in non/​toxic (0.009 microM) and toxic (5 microM) concentrations resulted
in sinergetic increase of the frequency of aberrant cells in Allium cepa root
meristem. Decrease of the mutagenic effect to the additive level and antagonism
with respect to the cytotoxic one was observed only at the certain
concentrations of 232Th (0.8 microM) and Cd (0.09 microM) and the time of impact
30 h. In contrast to the heavy metal cadmium the essential for plants potassium
at all studied concentrations (0.008, 6, 13 mM) decreased the number of
cytogenetic aberrations in control experiments and under the effect of 232Th.
The maximum protective effect of potassium was detected at the concentration 13
mM.

Publication Types:
English Abstract

PMID: 17243377 [PubMed /​ indexed for MEDLINE]

3: J Agric Food Chem. 2007 Jan 24;55(2):347/​54.

Determination of the geographic origin of onions between three main production
areas in Japan and other countries by mineral composition.

Ariyama K, Aoyama Y, Mochizuki A, Homura Y, Kadokura M, Yasui A.

Center for Food Quality, Labeling and Consumer Services, Saitama Shintoshin Godo
Chosa Kensa Building, 2/​1 Shintoshin, Chuo/​ku, Saitama City 330/​9731, Japan.
kaoru_ariyama@cfqlcs.go.jp

Onions (Allium cepa L.) are produced in many countries and are one of the most
popular vegetables in the world, thus leading to an enormous amount of
international trade. It is currently important that a scientific technique be
developed for determining geographic origin as a means to detect fraudulent
labeling. We have therefore developed a technique based on mineral analysis and
linear discriminant analysis (LDA). The onion samples used in this study were
from Hokkaido, Hyogo, and Saga, which are the primary onion/​growing areas in
Japan, and those from countries that export onions to Japan (China, the United
States, New Zealand, Thailand, Australia, and Chile). Of 309 samples, 108 were
from Hokkaido, 52 were from Saga, 77 were from Hyogo, and 72 were from abroad.
Fourteen elements (Na, Mg, P, Mn, Co, Ni, Cu, Zn, Rb, Sr, Mo, Cd, Cs, and Ba) in
the samples were determined by frame atomic adsorption spectrometry, inductively
coupled plasma optical emission spectrometry, and inductively coupled plasma
mass spectrometry. The models established by LDA were used to discriminate the
geographic origin between Hokkaido and abroad, Hyogo and abroad, and Saga and
abroad. Ten/​fold cross/​validations were conducted using these models. The
discrimination accuracies obtained by cross/​validation between Hokkaido and
abroad were 100 and 86%, respectively. Those between Hyogo and abroad were 100
and 90%, respectively. Those between Saga and abroad were 98 and 90%,
respectively. In addition, it was demonstrated that the fingerprint of an
element pattern from a specific production area, which a crop receives, did not
easily change by the variations of fertilization, crop year, variety, soil type,
and production year if appropriate elements were chosen.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 17227064 [PubMed /​ in process]

4: Plant Physiol Biochem. 2006 Nov 2; [Epub ahead of print]

Isolation, characterization and expression of a gene from Brassica napus
encoding a LIM/​domain protein.

Huang RZ, Wu XL, Jiang CZ, Hu ZH, He HY, Liou ZH, Xu YH, Jin W, Zheng T, Chen
JQ.

Institute for Virology and Biotechnology, Zhejiang Academy of Agricultural
Sciences, Key Laboratory of Plant Metabolic Engineering of Zhejiang Province,
Hangzhou 310021, China.

LIM proteins are important eucaryotic developmental regulators and also involved
in the transcriptional control of lignification. Based on expressed sequence tag
(EST) database and contig analysis, the coding region of a gene encoding a
LIM/​domain protein (BnLIM) was obtained by reverse transcription polymerase
chain reactions (RT/​PCR) from seeds of Brassica napus L. 20 days after anthesis
(DAA). The deduced BnLIM protein is 189 amino acids long and contains two LIM
domains separated by a 47/​residue spacer region. It is highly identical to the
LIM/​domain protein of NtLIM1 (Nicotiana tabacum L.), HaWLIM1 (Helianthus annuus
L.), PkLIM1 (Populus kitakamiensis) and EgLIM1 (Eucalyptus globulus). A genomic
copy of the gene has also been isolated and sequenced; it is split by four
short, AT/​rich introns. The BnLIM gene transcript was detected by RT/​PCR in all
vegetative and reproductive plant organs. The expression level of BnLIM gene
changed during seed development, which increased in early stage, peaked at 23/​29
DAA during seeds filling up to a maximal level and reduced slightly 32 DAA. The
expression profile of BnLIM gene was highly similar to that of Cinnamoyl/​CoA
reductase (CCR, EC 1.2.1.44), a key lignin biosynthesis gene. Transient
expression of BnLIM/​green fluorescent protein (GFP) fusion protein in onion
(Allium cepa) epidermal cells demonstrated the encoded protein BnLIM exhibited a
dual subcellular localization, i.e. in the nucleus and cytoplasm. BnLIM mRNA
accumulation in response to sucrose treatment was also investigated. All these
results proposed that BnLIM plays some roles in lignin biosynthesis and its
expression is developmentally regulated.

PMID: 17223349 [PubMed /​ as supplied by publisher]

5: J Herb Pharmacother. 2006;6(2):31/​41.

The use of medicinal herbs by diabetic Jordanian patients.

Otoom SA, Al/​Safi SA, Kerem ZK, Alkofahi A.

Department of Pharmacology, Faculty of Medicine, Jordan University of Science
and Technology, Irbid/​Jordan. sotoom@rcsi/​mub.com

Diabetes mellitus is the most common metabolic disorder worldwide. To date,
there have been no reports on the frequency of use of herb medicines in the
managements of diabetes mellitus in Jordan. This cross/​sectional study was
conducted by interviewing 310 diabetic patients visiting two medical centers in
Jordan: Jordan University of Science & Technology Medical Center and Sarih
Medical Center between December 2003 and August 2004. It is found that 31% of
interviewed patients have used herbal products (96 patients). The results
revealed that the most commonly used herbs by diabetic patients in Jordan were
Trigonella foenumgraecum (22.9%), Lupinus albus (14.6%), Allium sativum (11.5%),
Allium cepa (5.2%), Nigella sativa (7.3%), Zea mays L. (6.3%), Urtica dioica L.
(8.3%), Eucalyptus globules LA (9.4%), Olea europea L. (3.1%), Cumminum cyminum
(9.4%), Coriandrum sativum (10.4%), Salvia officinalis L. (3.1%), and Tilia
cordata (1%). Furthermore, it is found that 47.9% of the patients used herbs
according to advice from their friends on a daily basis. The side effects were
reported by 36.5% of the patients and include headache, nausea, dizziness,
itching, palpitation, and sweating. Among the patients, 72.9% used the herbs as
adjunctive therapy along with their anti/​diabetic drugs and 80.2% of the
patients informed their physicians about their use. A 79.2% of the sample
confirmed their intention to re/​use these herbs as 86.5% of them were satisfied
with their diabetes control. There was a significant relationship between the
use of herbs, the patient's place of residence and his/her level of education.
The main conclusion of this survey is that the use of medicinal herbs among
diabetic patient in Jordan is common. Therefore, it is essential to increase the
level of awareness among diabetic patients and health care providers regarding
the efficacy and toxicity of these medicinal herbs.

PMID: 17182483 [PubMed /​ indexed for MEDLINE]

6: Chemosphere. 2007 Apr;67(6):1211/​7. Epub 2006 Dec 8.

Evaluation of genotoxicity and toxicity of water and sediment samples from a
Brazilian stream influenced by tannery industries.

Junior HM, Silva J, Arenzon A, Portela CS, Ferreira IC, Henriques JA.

Centre for Leather Technology, Servico Nacional de Aprendizagem Industrial
(SENAI), Estancia Velha 93600/​000, RS, Brazil; Biotechnology Centre, Biophysics
Department, Federal University of Rio Grande do Sul (UFRGS), Porto Alegre,
Brazil.

This paper reports results of genotoxicity and toxicity studies of water and
sediment samples collected from the Estancia Velha stream of southern Brazil, a
stream transporting both domestic sewage and effluents from regional factories
working in the leather industry. Three sites were selected: in the stream
headwaters (Site 1), located downstream of an urban area (Site 2), and near the
basin outfall (Site 3). Results obtained with Allium cepa showed no evidence of
chromosomal mutation, either in water or in sediment, during winter or summer
seasons, but samples collected below Site 1 showed high toxicity. Physical and
chemical analyses showed high concentrations of pollutants at these sites.
Ecotoxicity tests with Daphnia magna and Ceriodaphnia dubia measured toxicity in
water from Sites 2 and 3 in summer 2004. A toxic effect on Hyalella azteca was
only found in sediment from Site 3 during winter 2003 and summer 2004. The
results suggest that the synergy among different compounds in domestic and
industrial sewage discharges can make it difficult to maintain system stability.

PMID: 17157352 [PubMed /​ in process]

7: J Appl Microbiol. 2006 Dec;101(6):1292/​300.

Host/​derived media used as a predictor for low abundant, in planta metabolite
production from necrotrophic fungi.

Overy DP, Smedsgaard J, Frisvad JC, Phipps RK, Thrane U.

Institute of Biological Sciences, Edward Llwyd Building, University of Wales,
Ceredigion, UK. dao@aber.ac.uk

AIMS: Penicillium ser. Corymbifera strains were assayed on a variety of media
and from infected Allium cepa tissues to evaluate the stimulation and in planta
prediction of low abundance metabolites. METHODS AND RESULTS: Stimulated
production of corymbiferones and the corymbiferan lactones were observed for
Penicillium albocoremium, Penicillium allii, Penicillium hirsutum, Penicillium
hordei and Penicillium venetum strains cultured on tissue media. Target
metabolites were sporadically detected from strains cultured on common
laboratory media (CYA, MEA and YES). Up to a 376 times increase in corymbiferone
and corymbiferan lactone production was observed when culture extracts from CYA
and A. cepa agar were compared by high pressure liquid chromatography with
ultraviolet and mass spectrometry (LC/​UV/​MS). The novel metabolite corymbiferone
B was purified and structure elucidated from a P. allii/A. cepa tissue medium
extract. In planta expression of low abundance, target metabolites were
confirmed from infected A. cepa tissue extracts by LC/​UV/​MS. CONCLUSIONS:
Secondary metabolite production was directly dependent and influenced by media
conditions, resulting in the stimulated production of low abundance metabolites
on host/​derived media. SIGNIFICANCE AND IMPACT OF THE STUDY: The use of
macerated host tissue media can be applied in vitro to predict in planta
expression of low abundance metabolites and aid in metabolite origin annotation
during in planta metabolomic investigations at the host/pathogen interface.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 17105559 [PubMed /​ in process]

8: Anal Chem. 2006 Nov 15;78(22):7616/​24.

In vivo investigation of the distribution and the local speciation of selenium
in Allium cepa L. by means of microscopic X/​ray absorption near/​edge structure
spectroscopy and confocal microscopic X/​ray fluorescence analysis.

Bulska E, Wysocka IA, Wierzbicka ML, Proost K, Janssens K, Falkenberg G.

Faculty of Chemistry, Warsaw University, Warsaw, Poland. ebulska@ chem.uw.edu.pl

In this work, microscopic X/​ray absorption near/​edge structure spectroscopy
(mu/​XANES) and confocal microscopic X/​ray fluorescence analysis (mu/​XRF) were
used for the in vivo determination of the distribution of total selenium and for
the local speciation of selenium in roots and leaves of onion. Selected Allium
cepa L. plants were grown hydroponically in a standard medium containing
inorganic selenium compounds (selenite or selenate). The measurements were
performed in vivo, that is, on living plants without the need for any form of
sampling or sample pretreatment and without the necessity for cutting plant
tissues into pieces. Distinct energy differences of the XANES spectra of various
selenium reference compounds having different oxidation states allow adjusting
the excitation energies used for mu/​XRF mapping in such a manner that the
distribution of selenium in various oxidation states is obtained with a spatial
resolution of a few tens of micrometers within the virtual cross section of the
onion tissues. We find that the ratio of inorganic to amino acid selenium
compounds differs in various subparts of the plant. Detailed in vivo
investigation of the distribution of various selenium species in virtual cross
sections of root tips and green leaf shows that the selenium transport takes
place via different mechanisms, depending on the nature of the selenium
compounds originally taken up.

PMID: 17105151 [PubMed /​ indexed for MEDLINE]

9: Plant Physiol. 2007 Jan;143(1):188/​98. Epub 2006 Nov 10.

Arabidopsis sucrose transporter AtSUC9. High/​affinity transport activity,
intragenic control of expression, and early flowering mutant phenotype.

Sivitz AB, Reinders A, Johnson ME, Krentz AD, Grof CP, Perroux JM, Ward JM.

Department of Plant Biology, University of Minnesota, St. Paul, Minnesota 55108,
USA.

AtSUC9 (At5g06170), a sucrose (Suc) transporter from Arabidopsis (Arabidopsis
thaliana) L. Heynh., was expressed in Xenopus (Xenopus laevis) oocytes, and
transport activity was analyzed. Compared to all other Suc transporters, AtSUC9
had an ultrahigh affinity for Suc (K(0.5) = 0.066 +//​ 0.025 mm). AtSUC9 showed
low substrate specificity, similar to AtSUC2 (At1g22710), and transported a wide
range of glucosides, including helicin, salicin, arbutin, maltose, fraxin,
esculin, turanose, and alpha/​methyl/​d/​glucose. The ability of AtSUC9 to
transport 10 glucosides was compared directly with that of AtSUC2, HvSUT1 (from
barley [Hordeum vulgare]), and ShSUT1 (from sugarcane [Saccharum hybrid]), and
results indicate that type I and type II Suc transporters have different
substrate specificities. AtSUC9 protein was localized to the plasma membrane by
transient expression in onion (Allium cepa) epidermis. Using a whole/​gene
translational fusion to beta/​glucuronidase, AtSUC9 expression was found in sink
tissues throughout the shoots and in flowers. AtSUC9 expression in Arabidopsis
was dependent on intragenic sequence, and this was found to also be true for
AtSUC1 (At1g71880) but not AtSUC2. Plants containing mutations in Suc
transporter gene AtSUC9 were found to have an early flowering phenotype under
short/​day conditions. The transport properties of AtSUC9 indicate that it is
uniquely suited to provide cellular uptake of Suc at very low extracellular Suc
concentrations. The mutant phenotype of atsuc9 alleles indicates that AtSUC9
activity leads to a delay in floral transition.

Publication Types:
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 17098854 [PubMed /​ in process]

10: J Ethnopharmacol. 2007 Mar 21;110(2):294/​304. Epub 2006 Oct 13.

Ethnopharmacological survey of medicinal herbs in Jordan, the Ajloun Heights
region.

Aburjai T, Hudaib M, Tayyem R, Yousef M, Qishawi M.

Department of Pharmaceutical Sciences, Faculty of Pharmacy, University of
Jordan, Amman 11942, Jordan.

The study of local knowledge about natural resources is becoming increasingly
important in defining strategies and actions for conservation of medicinal
plants. This study therefore sought to collect information from local population
concerning the use of Ajloun Heights region medicinal plants; identify the most
important species used; determine the relative importance of the species
surveyed and calculate the informant consensus factor (ICF) in relation to
medicinal plant use. Data collection relied predominantly on qualitative tools
to record the interviewee's personal information and topics related to the
medicinal use of specific plants. Our results revealed that 46 plant species
grown in the study region are still in use in traditional medicine for the
treatment of various diseases. Most of the locals interviewed dealt with
well/​known safe medicinal plants such as Achillea falcata, Matricaria aurea,
Majorana syriaca, Allium sativum and Allium cepa. The use of moderately unsafe
or toxic plants was noted to be practiced by practitioners and herbalists rather
than the locals. These plants include Ecballium elaterium, Euphorbia
hierosolymitana, Mandragora autumnalis and Citrullus colocynthis. Kidney
problems scored the highest ICF while Crocus hyemalis was the plant of highest
use value. Searching the literature evidenced some concordance with the
solicited plant uses mentioned by the informants.

PMID: 17097250 [PubMed /​ in process]

11: Am J Clin Nutr. 2006 Nov;84(5):1027/​32.

Onion and garlic use and human cancer.

Galeone C, Pelucchi C, Levi F, Negri E, Franceschi S, Talamini R, Giacosa A, La
Vecchia C.

Istituto di Ricerche Farmacologiche "Mario Negri," Milan, Italy, Italy.
galeone@marionegri.it

BACKGROUND: Interest in the potential benefits of allium vegetables, in
particular, onion (Allium cepa) and garlic (Allium sativum), has its origin in
antiquity, but the details of these benefits are still open to discussion.
OBJECTIVE: We investigated the role of allium vegetables in the etiology of
various neoplasms. Previous data are scanty and are based mainly on Chinese
studies. DESIGN: Using data from an integrated network of Italian and Swiss
case/​control studies, we analyzed the relation between frequency of onion and
garlic use and cancer at several sites. We calculated odds ratios (ORs) by using
multivariate logistic regression models that were adjusted for energy intake and
other major covariates. RESULTS: Consumption of onions varied between 0/​14 and
0/​22 portions/wk among cases and controls, respectively. The multivariate ORs
for the highest category of onion and garlic intake were, respectively, 0.16 and
0.61 for cancer of the oral cavity and pharynx, 0.12 and 0.43 for esophageal
cancer, 0.44 and 0.74 for colorectal cancer, 0.17 and 0.56 for laryngeal cancer,
0.75 and 0.90 for breast cancer, 0.27 and 0.78 for ovarian cancer, 0.29 and 0.81
for prostate cancer, and 0.62 and 0.69 for renal cell cancer. CONCLUSIONS: This
uniquely large data set from southern European populations shows an inverse
association between the frequency of use of allium vegetables and the risk of
several common cancers. Allium vegetables are a favorable correlate of cancer
risk in Europe.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 17093154 [PubMed /​ indexed for MEDLINE]

12: Fitoterapia. 2007 Jan;78(1):52/​68. Epub 2006 Sep 23.

Contribution to the knowledge of the folk plant medicine in Calabria region
(Southern Italy).

Passalacqua NG, Guarrera PM, De Fine G.

Museo di Storia Naturale della Calabria ed Orto Botanico, Universita della
Calabria, 87030 Arcavacata di Rende, Italy.

A series of research on plants used in Calabria (Southern Italy) in the folk
plant medicine was carried out in the last twenty years. The use of 104 taxa
distributed into 42 families are described. Among the major findings: Ceterach
officinarum as hypotensive; Heliotropium europaeum in the case of urinary
inflammations; Silybum marianum for haemorrhoids; Arundo donax for pertussis and
cystitis; Allium cepa for sties and flu; Laurus nobilis as galactagogue;
Passiflora incarnata for burns, haemorrhoids and skin inflammations;
Scrophularia canina for rhagas and wounds; Urtica membranacea for tussis and
tonsillitis.

PMID: 17084993 [PubMed /​ in process]

13: J Ethnopharmacol. 2007 Mar 1;110(1):105/​17. Epub 2006 Sep 23.

Ethnopharmacological survey of plants used in the traditional treatment of
hypertension and diabetes in south/​eastern Morocco (Errachidia province).

Tahraoui A, El/​Hilaly J, Israili ZH, Lyoussi B.

UFR Physiology/​Pharmacology, Laboratory of Animal Physiology, Department of
Biology, Faculty of Sciences, Dhar El Mehraz, USMBA, BP 1976 Atlas Fez, Morocco.

This survey was undertaken in the Errachidia province in south/​eastern Morocco
in order to inventory the main medicinal plants used in folk medicine to treat
arterial hypertension and diabetes mellitus. Four hundred individuals who knew
about and/or had used the medicinal plants for the indicated diseases, including
some herbal healers, were interviewed throughout different regions of the
province. The inventory of medicinal plants is summarized in a synoptic table,
which contains the scientific, vernacular and common name of the plant, its
ecological distribution, the part of the plant and the preparation used and the
therapeutic indication. Extensive investigations have brought to light 64
medicinal plants belonging to 33 families; of these, 45 are used for diabetes,
36 for hypertension, and 18 for both diseases. Of these plants, 34% grow in the
wild, 44% are cultivated, and 22% are not indigenous to the area and are brought
from other parts of Morocco or from outside the country. The survey shows that
78% of the patients regularly use these medicinal plants. In this region, the
most frequently used plants to treat diabetes include Ajuga iva, Allium cepa,
Artemisia herba/​alba, Carum carvi, Lepidium sativum, Nigella sativa, Olea
europaea, Peganum harmala, Phoenix dactylifera, Rosmarinus officinalis, and
Zygophyllum gaetulum, and those to treat hypertension include Ajuga iva, Allium
cepa, Allium sativum, Artemisia herba/​alba Asso, Carum carvi, Nigella sativa,
Olea europea, Rosmarinus officinalis, Origanum majorana, Peganum harmala, and
Phoenix dactylifera. The local people recognize the toxic plants and are very
careful in using such plants, which are Citrullus colocynthis, Datura
stramonium, Nerium oleander, Nigella sativa, Peganum harmala and Zygophyllum
gaetulum. Our survey shows that traditional medicine in the south/​eastern
Moroccan population has not only survived but has thrived in the transcultural
environment and intermixture of many ethnic traditions and beliefs.

PMID: 17052873 [PubMed /​ in process]

14: Genes Genet Syst. 2006 Aug;81(4):255/​63.

Complete assignment of structural genes involved in flavonoid biosynthesis
influencing bulb color to individual chromosomes of the shallot (Allium cepa
L.).

Masuzaki S, Shigyo M, Yamauchi N.

The United Graduate School of Agricultural Sciences, Tottori University,
Tottori, Japan.

We analyzed Japanese bunching onion (Allium fistulosum L.) /​ shallot (Allium
cepa L. Aggregatum group) alien chromosome addition lines in order to assign the
genes involved in the flavonoid biosynthesis pathway to chromosomes of the
shallot. Two complete sets of alien monosomic additions (2n = 2x + 1 = 17) were
used for determining the chromosomal locations of several partial sequences of
candidate genes, CHS, CHI, F3H, DFR, and ANS via analyses of PCR/​based markers.
The results of DNA marker analyses showed that the CHS/​A, CHS/​B, CHI, F3H, DFR,
and ANS genes should be assigned to chromosomes 2A, 4A, 3A, 3A, 7A, and 4A,
respectively. HPLC analyses of 14 A. fistulosum /​ shallot multiple alien
additions (2n = 2x + 2 /​ 2x + 7 = 18 /​ 23) were conducted to identify the
anthocyanin compounds produced in the scaly leaves. A direct comparison between
the genomic constitution and the anthocyanin compositions of the multiple
additions revealed that a 3GT gene for glucosylation of anthocyanidin was
located on 4A. Thus, we were able to assign all structural genes involved in
flavonoid biosynthesis influencing bulb color to individual chromosomes of A.
cepa.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 17038797 [PubMed /​ indexed for MEDLINE]

15: Theor Appl Genet. 2006 Dec;114(1):31/​9. Epub 2006 Sep 22.

Comparative sequence and genetic analyses of asparagus BACs reveal no
microsynteny with onion or rice.

Jakse J, Telgmann A, Jung C, Khar A, Melgar S, Cheung F, Town CD, Havey MJ.

Department of Horticulture, University of Wisconsin, 1575 Linden Drive, Madison,
WI 53706, USA.

The Poales (includes the grasses) and Asparagales [includes onion (Allium cepa
L.) and asparagus (Asparagus officinalis L.)] are the two most economically
important monocot orders. The Poales are a member of the commelinoid monocots, a
group of orders sister to the Asparagales. Comparative genomic analyses have
revealed a high degree of synteny among the grasses; however, it is not known if
this synteny extends to other major monocot groups such as the Asparagales.
Although we previously reported no evidence for synteny at the recombinational
level between onion and rice, microsynteny may exist across shorter genomic
regions in the grasses and Asparagales. We sequenced nine asparagus BACs to
reveal physically linked genic/​like sequences and determined their most similar
positions in the onion and rice genomes. Four of the asparagus BACs were
selected using molecular markers tightly linked to the sex/​determining M locus
on chromosome 5 of asparagus. These BACs possessed only two putative coding
regions and had long tracts of degenerated retroviral elements and transposons.
Five asparagus BACs were selected after hybridization of three onion cDNAs that
mapped to three different onion chromosomes. Genic/​like sequences that were
physically linked on the cDNA/​selected BACs or genetically linked on the
M/​linked BACs showed significant similarities (e < /​20) to expressed sequences
on different rice chromosomes, revealing no evidence for microsynteny between
asparagus and rice across these regions. Genic/​like sequences that were linked
in asparagus were used to identify highly similar (e < /​20) expressed sequence
tags (ESTs) of onion. These onion ESTs mapped to different onion chromosomes and
no relationship was observed between physical or genetic linkages in asparagus
and genetic linkages in onion. These results further indicate that synteny among
grass genomes does not extend to a sister order in the monocots and that
asparagus may not be an appropriate smaller genome model for plants in the
Asparagales with enormous nuclear genomes.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 17016688 [PubMed /​ indexed for MEDLINE]

16: Mutat Res. 2007 Jan 10;626(1/​2):4/​14. Epub 2006 Sep 26.

Genotoxicity of five food preservatives tested on root tips of Allium cepa L.

Turkoglu S.

Cumhuriyet University, Faculty of Arts and Science, Department of Biology,
Sivas, Turkey. turkoglu@cumhuriyet.edu.tr

The effects of the food preservatives sodium benzoate (SB), boric acid (BA),
citric acid (CA), potassium citrate (PC) and sodium citrate (SC) have been
studied on root tips of Allium cepa L. Roots of A. cepa were treated with a
series of concentrations, ranging from 20 to 100 ppm for 5, 10 and 20 h. The
results indicate that these food preservatives reduced mitotic division in A.
cepa compared with the respective control. Mitotic index values were generally
decreased with increasing concentrations and longer treatment times.
Additionally, variations in the percentage of mitotic stages were observed. The
total percentage of aberrations generally increased with increasing
concentrations of these chemicals and the longer period of treatment. Different
abnormal mitotic figures were observed in all mitotic phases. Among these
abnormalities were anaphase bridges, C/​mitosis, micronuclei, lagging,
stickiness, breaks and unequal distribution.

PMID: 17005441 [PubMed /​ indexed for MEDLINE]

17: J Ethnopharmacol. 2007 Feb 12;109(3):367/​71. Epub 2006 Aug 22.

Lipid lowering effect of S/​methyl cysteine sulfoxide from Allium cepa Linn in
high cholesterol diet fed rats.

Kumari K, Augusti KT.

Department of Biochemistry, University of Kerala, Kariavattom, Trivandrum
695581, Kerala, India.

The lipid lowering action of S/​methyl cysteine sulfoxide (SMCS) isolated from
Allium cepa Linn (family: Liliaceae) was investigated in Sprague/​Dawley rats fed
on 1% cholesterol diet, in comparison to the hypolipidemic drug gugulipid.
Administration of SMCS at a dose of 200mg/kg body weight for 45 days ameliorated
the hyperlipidemic condition. The lipid profile in serum and tissues showed that
concentrations of cholesterol, triglyceride and phospholipids were significantly
reduced when compared to their untreated counterparts. The total lipoprotein
lipase activity in the adipose tissue was decreased with also a decrease in the
free fatty acid levels in serum and tissues. The activities of the lipogenic
enzymes glucose 6/​phosphate dehydrogenase and malic enzyme as also of HMG CoA
reductase in the tissues remained low on treatment indicating that both the
drugs did not favor lipogenesis and cholesterogenesis in the hyperlipidemic
animals. The fecal excretion of bile acids and sterols was further increased
upon treatment with the drugs. The results are directive to that both gugulipid
and SMCS cause reduction of endogenous lipogenesis, increase catabolism of
lipids and subsequent excretion of metabolic by/​products through the intestinal
tract. However, gugulipid is a better drug than SMCS at a low dose of 50mg/kg
body weight.

PMID: 16987625 [PubMed /​ in process]

18: Biocell. 2006 Aug;30(2):259/​67.

Determination of vanadium accumulation in onion root cells (Allium cepa L.) and
its correlation with toxicity.

Marcano L, Carruyo I, Fernandez Y, Montiel X, Torrealba Z.

Universidad del Zulia, Facultad Experimental de Ciencias, Departamento de
Biologia, Maracaibo, Estado Zulia, Venezuela. letty_marcano@hotmail.com

The vanadium is a metal that presents great interest from the toxicological
point of view, because of the numerous alterations that can take place in
different biological systems. This work evaluated the capacity of vanadium
accumulation and its correlation with genotoxic effects in root cells of Allium
cepa L. The bulbs were cultivated in renovated filtered water each 24 h, at a
temperature of 25 +//​ 0.5 degrees C, in darkness and constant aeration.
Treatments were carried out under the same experimental conditions, using water
solutions of vanadium of 25, 50, 75 and 100 microg/g for 0, 12, 24, 48 and 72 h.
A control was carried out where metal solution was substituted by distilled
water. After the treatment, the meristems were fixed with alcohol/​/​acetic acid
(3:1) and stained according to the technique of Feulgen. The capacity of
accumulation was determined by GFAAS. The analysis of the results revealed an
accumulation of the metal for all times and concentrations. No correlation was
presented among vanadium accumulation, growth and mitotic index; however,
positive correlation was given with the induction of chromosomic aberrations. In
conclusion, vanadium is able to induce cytotoxic effect in the exposed roots,
but only genotoxic effect was correlated with metal accumulation.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16972550 [PubMed /​ indexed for MEDLINE]

19: Ying Yong Sheng Tai Xue Bao. 2006 Jun;17(6):1137/​40.

[Inhibitory effects of natural plant extracts on Verticillium albo/​atrum]

[Article in Chinese]

Zhang S, Zhou B, Zhang L, Fu Y.

College of Horticulture, Shenyang Agricultural University, Shenyang 110161,
China. zhangsh024@163.com

This paper studied the inhibitory effects of 54 kinds of ethanol/​extracted plant
solutions on Verticillium albo/​atrum. The results showed that 15 kinds of these
extracts could inhibit the growth of verticillium albo/​atrum mycelium, with an
inhibitory rate more than 50%, among which, the inhibitory rate of Asarum
sieboldii, Coptis chinensis, Magnolia officinalis, Acacia catechu, Sophora
flavescens, Glycyrrhiza uralensis, Cnidium monnieri, Platycodon grandiflorum and
Allium. cepa. extracts was higher than 65%, and that of Cnidium monnieri extract
reached 86.84%. A total of 16 kinds of plant extracts decreased the spore
germination of V. albo/​atrum, with the inhibitory rate higher than 70%, and
there were 7 kinds of plant extracts whose inhibitory rate reached 95%. Almost
no spore bourgeon was found after treated with Asarum sieboldii, Coptis
chinensis, and Magnolia officinalis extracts. The extract of Acacia catechu did
not inhibit the growth of mycelium, but restrained the spore germination by
100%. Cnidium monnieri extract could strongly inhibit the growth of mycelium,
but had a less effect on spore germination rate (only by 11.3%). The active
substances found in natural plant extracts which had the inhibitory effects on
pathogen brought us a new and promising method to deal with V. albo/​atrum and
other vegetable diseases.

Publication Types:
English Abstract
Research Support, Non/​U.S. Gov't

PMID: 16964957 [PubMed /​ indexed for MEDLINE]

20: Int J Pharm. 2006 Dec 11;327(1/​2):6/​11. Epub 2006 Jul 25.

The study of drug permeation through natural membranes.

Ansari M, Kazemipour M, Aklamli M.

Department of Pharmaceutics, Faculty of Pharmacy, Kerman Medical Sciences
University, Kerman, Iran. mansari@kmu.ac.ir

In this study, natural membranes such as the outer membrane of Prunus persica
(peach) and Lycopersicon esculentum (tomato), the inner layer of the egg of
Gallus domesticus (hen) and the middle membrane of the Allium cepa (onion) were
used as controlling barriers for permeation of some model drugs with different
MW and lipophilicities. Drug permeation studies were done by using modified
Franz diffusion cell. The permeation of drugs through these natural membranes
was compared to permeation of them through human skin and synthetic cellophane
membrane. Results showed that the rate and amount of diclofenac permeated
through onion membrane was not significantly different from that with tomato
(p>0.17), egg (p>0.29) and human skin (p>0.93). Permeation of diclofenac through
tomato skin and cellophane was not significantly different (p>0.35). Permeation
of diclofenac through all studied membranes except for human skin that follows
the Fickian kinetic followed non/​Fickian mechanism and their permeabilities were
not significantly different from each other (p>0.05). Permeation of
metronidazole through onion membrane and tomato skin were not significantly
different from human skin (p>0.053 and 0.38, respectively). All membranes were
significantly different from each other (p<0.0001) for permeation of
erythromycin as a relatively large molecular weight and lipohilic molecule
through human skin and other studied membranes. Permeation of diclofenac through
human skin and metronidazole through egg and tomato skin followed Fick's first
law. Diffusion of diclofenac through onion, tomato, egg, cellophane, and peach;
metronidazole through onion, peach, cellophane, and human skin, and erythromycin
through all studied membranes followed non/​Fickian mechanism for diffusion.
Statistical analysis showed the most similarity between onion and human skin for
diclofenac, tomato and human skin for metronidazole, onion and cellophane for
erythromycin.

PMID: 16959447 [PubMed /​ in process]

21: Indian J Biochem Biophys. 2005 Dec;42(6):371/​7.

Induction of resistance in host against the infection of leaf blight pathogen
(Alternaria palandui) in onion (Allium cepa var aggregatum).

Karthikeyan M, Jayakumar V, Radhika K, Bhaskaran R, Velazhahan R, Alice D.

Department of Plant Pathology, Center for Plant Protection Studies, Tamil Nadu
Agricultural University, Coimbatore, India. karthipath@rediffmail.com

The Pseudomonas fluorescens isolate Pfl was found to inhibit the growth of
pathogen Alternaria palandui, in vitro. In the present study, foliar application
of a talc/​based formulation of Pfl significantly reduced the incidence of leaf
blight of onion, caused by A. palandui. Induction of defense/​related proteins
viz., chitinase, beta/​1,3 glucanase, peroxidase (PO) and polyphenol oxidase
(PPO) by application of Pfl, was studied against A. palandui infection in
resistant (IHR 56) and susceptible (MDUI) onion cultivars. Chitinase in both
cultivars, with or without challenge/​inoculation of A. palandui revealed changes
in the isoform pattern. The Native/​PAGE of PO showed induction of PO2 isoform in
both the cultivars, in response to inoculation of pathogen. Isoform analysis of
PPO also exhibited induction in the Pfl/​treated plants challenged with pathogen.
Similarly, the activity of beta/​1,3/​glucanase was greatly induced in Pfl/​treated
plants, challenged with pathogen as compared to controls. Thus, the P.
fluorescens/​treated plants showed significant increase in the levels of the
defense enzymes, in comparison to the plants challenged with the pathogen.

PMID: 16955738 [PubMed /​ indexed for MEDLINE]

22: J Agric Food Chem. 2006 Aug 23;54(17):6185/​91.

Quercetin content in field/​cured onions (Allium cepa L.): effects of cultivar,
lifting time, and nitrogen fertilizer level.

Mogren LM, Olsson ME, Gertsson UE.

Department of Crop Science, Swedish University of Agricultural Sciences, P.O.
Box 44, SE/​230 53 Alnarp, Sweden. lars.mogren@vv.slu.se

Variation in quercetin content was investigated in field/​cured onions (Allium
cepa L.) that had been supplied with different nitrogen fertilizer levels and
lifted at different developmental stages. Quercetin content varied significantly
between years and was well correlated to global radiation in August. Field
curing generally resulted in significant increases in quercetin content compared
to levels at lifting. Nitrogen fertilizer level did not affect quercetin
content, suggesting that nitrogen leakage from soil may be minimized without
effects on flavonol content. Lifting time had minor effects on quercetin content
in field/​cured onions. Cultivar differences in quercetin content were
significant but not consistent in all years. Quercetin content increased
significantly less in dark environments compared to field curing, but some
quercetin synthesis occurred regardless of light. Field curing with or without
foliage still attached did not affect quercetin content, suggesting that no
transportation from the foliage to the scales occurred.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16910706 [PubMed /​ indexed for MEDLINE]

23: Transgenic Res. 2006 Aug;15(4):435/​46.

Expression of the lipid transfer protein Ace/​AMP1 in transgenic wheat enhances
antifungal activity and defense responses.

Roy/​Barman S, Sautter C, Chattoo BB.

Department of Microbiology and Biotechnology Centre, Faculty of Science, The M.
S. University of Baroda, Vadodara 390 002, India.

To enhance fungal disease resistance, wheat plants (cv. Bobwhite) were
engineered to constitutively express the potent antimicrobial protein Ace/​AMP1
from Allium cepa, driven by a maize ubiquitin promoter along with its first
intron. The bar gene was used for selection of putative transformants on medium
containing phosphinothricin (PPT). Transgene inheritance, integration and
stability of expression were confirmed over two generations by PCR, Southern,
northern and western blot analyses, respectively. The levels of Ace/​AMP1 in
different transgenic lines correlated with the transcript levels of the
transgene. Up to 50% increase in resistance to Blumeria graminis f. sp. tritici
was detected in detached leaf assays. In ears of transgenic wheat inoculated
with Neovossia indica, Ace/​AMP1 intensified expression of defense/​related genes.
Elevated levels of salicylic acid and of transcripts of phenylalanine ammonia
lyase (PAL), glucanase (PR2) and chitinase (PR3) in the transgenic plants
indicated manifestation of systemic acquired resistance (SAR).

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16906444 [PubMed /​ indexed for MEDLINE]

24: Mutat Res. 2006 Oct 10;609(1):81/​91. Epub 2006 Aug 2.

Genotoxicity of industrial wastewaters obtained from two different pollution
sources in northern India: a comparison of three bioassays.

Fatima RA, Ahmad M.

Department of Biochemistry, Faculty of Life Sciences, AMU, Aligarh 202002,
India.

The genotoxicity of industrial wastewater samples from Aligarh and Ghaziabad
cities was compared using the Ames plate incorporation test, the Ames
fluctuation test and the Allium cepa test. While TA102 and TA104 strains
exhibited the highest sensitivity against the Aligarh sample (AWW) in terms of
the slope (m) of the dose/​response curve in the plate incorporation assay, TA98
and TA97a were the most sensitive strains based on the induction factor, Mi(p).
TA98 once again, was the most sensitive strain against the test sample from
Ghaziabad (GWW) in terms of 'Mi(p)' while TA102 was the most sensitive strain on
the basis of the slope (m). TA100 displayed the highest susceptibility towards
the samples from Aligarh in the fluctuation test. However, TA102 and TA98
responded maximally to GWW in this bioassay. The mutagenicity of the test
samples seemed to be partly mediated by reactive oxygen species (ROS) as
evidenced by the use of free radical scavengers. Mannitol brought about the
maximum decline in the number of revertants of TA102 by the Aligarh sample,
whereas such a reduction in case of Ghaziabad sample was exhibited with
superoxide dismutase. Both the test water samples induced various anaphase
aberrations in the root cells of Allium cepa. Fragmentation of the chromosome
was the predominant effect of the Aligarh water sample while the Ghaziabad
sample induced chromosome stickiness. The crucial roles of heavy metals and
pesticides in the genotoxicity of AWW and GWW, respectively, have been
suggested. In view of the problem associated with the interpretations of data,
we recommend that all the test bioassays should be carried out in the presence
of ROS scavengers for the fool proof evaluation of the genotoxicity of water
samples.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 16887378 [PubMed /​ indexed for MEDLINE]

25: Biol Res. 2006;39(2):331/​40. Epub 2006 Jul 25.

The G2 checkpoint activated by DNA damage does not prevent genome instability in
plant cells.

Carballo JA, Pincheira J, de la Torre C.

Centro de Investigaciones Biologicas, CSIC, Madrid, Spain.

Root growth, G2 length, and the frequency of aberrant mitoses and apoptotic
nuclei were recorded after a single X/​ray irradiation, ranging from 2.5 to 40
Gy, in Allium cepa L. root meristematic cells. After 72 h of recovery, root
growth was reduced in a dose/​dependent manner from 10 to 40 Gy, but not at 2.5
or 5 Gy doses. Flow cytometry plus TUNEL (TdT/​mediated dUTP nick end labeling)
showed that activation of apoptosis occurred only after 20 and 40 Gy of X/​rays.
Nevertheless, irrespective of the radiation dose, conventional flow cytometry
showed that cells accumulated in G2 (4C DNA content). Simultaneously, the
mitotic index fell, though a mitotic wave appeared later. Cell accumulation in
G2 was transient and partially reversed by caffeine, thus it was
checkpoint/​dependent. Strikingly, the additional G2 time provided by this
checkpoint was never long enough to complete DNA repair. Then, in all cases,
some G2 cells with still/​unrepaired DNA underwent checkpoint adaptation, i.e.,
they entered into the late mitotic wave with chromatid breaks. These cells and
those produced by the breakage of chromosomal bridges in anaphase will reach the
G1 of the next cell cycle unrepaired, ensuring the appearance of genome
instability.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16874408 [PubMed /​ in process]

26: J Environ Biol. 2006 Jan;27(1):93/​5.

In vivo studies on the effect of Ocimum sanctum L. leaf extract in modifying the
genotoxicity induced by chromium and mercury in Allium root meristems.

Babu K, Uma Maheswari KC.

R & D Centre, Cholayil Pharmaceuticals Pvt. Ltd., Ambattur, Chennai/​600 098,
India.

In vivo cytogenetic assay in Allium cepa root tip cells has been carried out to
detect the modifying effect of Ocimum sanctum aqueous leaf extract against
chromium (Cr) and mercury (Hg) induced genotoxicity. It was observed that the
roots post/​treated with the leaf extract showed highly significant (p < 0.001)
recovery in mitotic index (MI) and chromosomal aberrations (CA) when compared to
pre/​treated (Cr/Hg) samples and the lower doses of the leaf extract were found
to be more effective than higher doses. The present study reveals that the
Ocimum sanctum leaf extract possesses the protective effect against Cr/Hg
induced genetic damage.

PMID: 16850883 [PubMed /​ indexed for MEDLINE]

27: Biocell. 2006 Apr;30(1):9/​13.

Evaluation of cytotoxic potential of latex of Calotropis procera and
podophyllotoxin in Allium cepa root model.

Sehgal R, Roy S, Kumar VL.

Department of Pharmacology, All India Institute of Medical Sciences, Ansari
Nagar, New Delhi /​ 110 029, India.

In the present study we have utilized the Allium cepa root tip meristem model to
evaluate the cytotoxic and anti/​mitotic activities of latex of Calotropis
procera (DL) and podophyllotoxin. Standard cytotoxic drug cyclophosphamide and
non/​cytotoxic drugs cyprohcptadine and aspirin served as controls. Like
cyclophosphamide, both DL and podophyllotoxin significantly inhibited the growth
of roots and mitotic activity in a dose/​dependent manner. However,
podophyllotoxin was more potent in this regard and produced root decay.
Cyproheptadine and aspirin, on the other hand, showed a marginal effect on the
root growth and mitotic activity at much higher concentrations.

PMID: 16845823 [PubMed /​ indexed for MEDLINE]

28: J Exp Bot. 2006;57(11):2719/​34. Epub 2006 Jul 13.

Erratum in:
J Exp Bot. 2006;57(14):3961.

Molecular and functional characterization of a cDNA encoding fructan:fructan
6G/​fructosyltransferase (6G/​FFT)/fructan:fructan 1/​fructosyltransferase (1/​FFT)
from perennial ryegrass (Lolium perenne L.).

Lasseur B, Lothier J, Djoumad A, De Coninck B, Smeekens S, Van Laere A,
Morvan/​Bertrand A, Van den Ende W, Prud'homme MP.

UMR INRA/​UCN 950 EVA Ecophysiologie Vegetale, Agronomie et Nutritions NCS,
Universite de Caen, Esplanade de la Paix, F/​14032 Caen cedex, France.

Fructans are the main storage compound in Lolium perenne. To account for the
prevailing neokestose/​based fructan synthesis in this species, a cDNA library of
L. perenne was screened by using the onion (Allium cepa) fructan:fructan
6G/​fructosyltransferase (6G/​FFT) as a probe. A full length Lp6G/​FFT clone was
isolated with significant homologies to vacuolar type fructosyltransferases and
invertases. The functionality of the cDNA was tested by heterologous expression
in Pichia pastoris. The recombinant protein demonstrated both 6G/​FFT and
fructan:fructan 1/​fructosyltransferase activities (1/​FFT) with a maximum
6G/​FFT/1/​FFT ratio of two. The activity of 6G/​FFT was investigated with respect
to developmental stage, tissue distribution, and alterations in carbohydrate
status expression and compared to sucrose:sucrose 1/​fructosyltransferase
(1/​SST). Lp6G/​FFT and Lp1/​SST were predominantly expressed in the basal part of
elongating leaves and leaf sheaths. Expression of both genes declined along the
leaf axis, in parallel with the spatial occurrence of fructan and
fructosyltransferase activities. Surprisingly, Lp6G/​FFT was highly expressed in
photosynthetically active tissues where very low extractable
fructosyltransferase activity and fructan amounts were detected, suggesting a
post/​transcriptional regulation of expression. Lp6G/​FFT gene expression
increased only in elongating leaves following similar increases of sucrose
content in blades, sheaths, and elongating leaf bases. Regulation of Lp6G/​FFT
gene expression depends on the tissue according to its sink/​source status.

PMID: 16840511 [PubMed /​ indexed for MEDLINE]

29: Mutat Res. 2006 Sep;613(1):17/​64. Epub 2006 Jul 7.

Zea mays assays of chemical/radiation genotoxicity for the study of
environmental mutagens.

Grant WF, Owens ET.

Department of Plant Science, P.O. Box 4000, McGill University, Macdonald Campus,
21, 111 Lakeshore Blvd., Ste. Anne de Bellevue, Quebec H9X 3V9, Canada.
william.grant@mcgill.ca

From a literature survey, 86 chemicals are tabulated that have been evaluated in
121 assays for their clastogenic effects in Zea mays. Eighty/​one of the 86
chemicals are reported as giving a positive reaction (i.e. causing chromosome
aberrations). Of these, 36 are reported positive with a dose response. In
addition, 32 assays have been recorded for 7 types of radiation, all of which
reacted positively. The results of 126 assays with 63 chemicals and 12 types of
radiation tested for the inductions of gene mutations are tabulated, as well as
63 chemicals and/or radiation in combined treatments. Three studies reported
positive results for mutations on Zea mays seed sent on space flights. The Zea
mays (2n=20) assay is a very good plant bioassay for assessing chromosome damage
both in mitosis and meiosis and for somatic mutations induced by chemicals and
radiations. The carcinogenicity and Salmonella assays correlate in all cases.
The maize bioassay has been shown to be as sensitive and as specific an assay as
other plant genotoxicity assays, such as Hordeum vulgare, Vicia faba, Crepis
capillaris, Pisum sativum, Lycopersicon esculentum and Allium cepa and should be
considered in further studies in assessing clastogenicity. Tests using Zea mays
can be made for a spectrum of mutant phenotypes of which many are identifiable
in young seedlings.

Publication Types:
Review

PMID: 16828334 [PubMed /​ indexed for MEDLINE]

30: Mol Cells. 2006 Jun 30;21(3):411/​7.

Determination of cytoplasmic male sterile factors in onion plants (Allium cepa
L.) using PCR/​RFLP and SNP markers.

Cho KS, Yang TJ, Hong SY, Kwon YS, Woo JG, Park HG.

National Institute of Highland Agriculture, Rural Development Administration,
Pyeongchang 232/​955, Korea. kscho@rda.go.kr

We have developed a polymerase chain reaction/​restriction fragment length
polymorphism (PCR/​RFLP) marker that can distinguish male/​fertile (N) and
male/​sterile (S) cytoplasm in onions. The PCR/​RFLP marker was located in a
chloroplast psbA gene amplicon. Digesting the amplicons from different
cytoplasm/​containing varieties with the restriction enzyme MspI revealed that
N/​cytoplasm plants have a functional MspI site (CCGG), whereas the S/​cytoplasm
plants has a substitution in that site (CTGG), and thus no MspI target. The
results obtained using this PCR/​RFLP marker to distinguish between cytoplasmic
male sterile factors in 35 onion varieties corresponded with those using a
CMS/​specific sequence/​characterized amplified region (SCAR) marker. Moreover,
the PCR/​RFLP marker can identify N/​ ot S/​cytoplasms in DNA sample mixtures in
which they are in up to a 10/​fold minority, indicating that use of the marker
has high diagnostic precision. We also demonstrated the usefulness of the SNP
detected in the psbA gene for high/​throughput discrimination of CMS factors
using Real/​time PCR and a TaqMan probe assay.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16819305 [PubMed /​ indexed for MEDLINE]

31: J Ethnopharmacol. 2006 Sep 19;107(2):211/​21. Epub 2006 Mar 27.

Changes in chromosome structure, mitotic activity and nuclear DNA content from
cells of Allium Test induced by bark water extract of Uncaria tomentosa (Willd.)
DC.

Kuras M, Nowakowska J, Sliwinska E, Pilarski R, Ilasz R, Tykarska T, Zobel A,
Gulewicz K.

Department of Ecotoxicology, Warsaw University, Miecznikowa 1, 02/​096 Warsaw,
Poland. kuras@biol.uw.edu.pl

The influence of water extract of Uncaria tomentosa (Willd.) DC bark on the
meristematic cells of the root tips of Allium cepa L., e.g. cells of Allium
Test, was investigated. The experiment was carried out in two variants: (1)
continuous incubation at different concentrations (2, 4, 8 and 16 mg/ml) of the
extract for 3, 6, 12, 24, 48 and 72h; and (2) 24/​h incubation in three
concentrations of the extract (4, 8 or 16 mg/ml), followed by post/​incubation in
distilled water for 3, 6, 12, 24 and 48h. During the continuous incubation, the
mitotic activity was reduced (2 and 4 mg/ml) or totally inhibited (8 and 16
mg/ml), depending on the concentration of the extract. All the concentrations
resulted in gradual reduction of the mitotic activity. In the concentration of 2
mg/ml, the mitotic activity reached its lowest value after 12h (2 mg/ml) and
after 24h in 4 mg/ml, followed by spontaneous intensification of divisions
during further incubation. Instead, in higher concentrations of the extracts (8
and 16 mg/ml), the mitotic activity was totally inhibited within 24h and did not
resume even after 72h. Incubation caused changes in the phase index, mainly as
an increase in the number of prophases. After 24h of incubation, in all phases,
condensation and contraction of chromosomes were observed. During
post/​incubation, divisions resumed in all concentrations, reaching even higher
values than the control. Cytometric analysis showed that the extract caused
inhibition of the cell cycle at the border between gap(2) and beginning of
mitosis (G(2)/M).

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16793229 [PubMed /​ indexed for MEDLINE]

32: J Environ Sci Health A Tox Hazard Subst Environ Eng. 2006;41(4):659/​74.

Detoxification and bioremediation potential of a Pseudomonas fluorescens isolate
against the major Indian water pollutants.

Ali Khan MW, Ahmad M.

Department of Biochemistry, Faculty of Life Sciences, Aligarh Muslim University,
Aligarh, India.

A Pseudomonas fluorescens strain was isolated from the soil of industrial estate
of Aligarh, India. This strain was resistant to some of the major Indian water
pollutants, namely Cd2+, Cr6+, Cu2+, Ni2+, Pb2+, BHC, 2,4/​D, mancozeb and
phenols up to the levels occurring in the highly polluted regions. Moreover, the
test strain seems to have a great potential for the detoxification of these
pollutants. The decrease in toxicity as determined by the Allium cepa test was
recorded as 62.5% for the model water containing the mixture of test heavy
metals, 71.9% for the pesticides, 73.2% for phenols, and 58.5% for combination
of all these toxicants. These values were obtained after 24 hours, exposure to
the immobilized cells of the test isolate in the calcium alginate matrix at the
concentrations of these polutants supposedly present in the highly polluted
water systems in India. The efficiency of bioremediation for certain heavy
metals at the same concentrations by means of immobilized cells of the test
Pseudomonas fluorescens isolate was estimated to be 75.9% for cadmium, 74.2% for
hexavalent chromium and 61.0% for lead during the 24 hours' treatment. In view
of the preliminary work, the test isolate seems to be a good candidate for the
bioremediation of water pollutants.

PMID: 16779939 [PubMed /​ indexed for MEDLINE]

33: Biotech Histochem. 2006 Jan/​Feb;81(1):13/​21.

CPD staining: an effective technique for detection of NORs and other GC/​rich
chromosomal regions in plants.

She CW, Liu JY, Song YC.

Key Laboratory of MOE for Plant Developmental Biology, College of Life Sciences,
Wuhan University, Wuhan, 430072, China.

Mitotic chromosome spreads of 16 plant species belonging to six families were
analyzed using an improved combined PI and DAPI (CPD) staining procedure.
Fluorescence in situ hybridization (FISH) with 45S rDNA probe was conducted
sequentially on the same spreads to evaluate the efficiency and sensitivity of
the technique. Fluorochrome staining with chromomycin A3 (CMA)/​DAPI also was
conducted to clarify the properties of the sequences involved in the CPD banded
regions. Our results revealed that all of the NORs (rDNA sites) in the species
tested were efficiently shown as red bands by CPD staining, and the number and
position of the bands corresponded precisely to those of the 45S rDNA FISH
signals, indicating that the detection sensitivity of CPD staining is similar to
that of FISH. In 10 of the species tested including Aegilops squarrosa, Allium
sativum, Oryza sativum ssp. indica, Oryza officinalis, Pisum sativum, Secale
cereale, Setaria italica, Sorghum vulgare, Vicia faba and Zea mays, CPD bands
were exhibited exclusively in their NORs, while in other six species including
Hordeum vulgare, Allium cepa, Psophocarpus tetragonolobus, Arabidopsis thaliana,
Brassica oleracea var. capitata and Lycopersicon esculentum, CPD bands appeared
in chromosomal regions other than their NORs. The CPD bands were in accordance
with the CMA bands in all species tested, indicating GC/​rich sequences in the
CPD bands and that the improved CPD staining procedure is specific for GC/​rich
regions in plant genomes. Our investigation not only elucidated the banding
mechanisms of CPD, but also demonstrated that the CPD staining technique, which
may be preferable to CMA staining, is an effective tool for detecting NORs and
other GC/​rich chromosomal regions in plants.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16760123 [PubMed /​ indexed for MEDLINE]

34: J Nat Prod. 2006 May;69(5):795/​800.

Sesquiterpene lactones as allelochemicals.

Macias FA, Fernandez A, Varela RM, Molinillo JM, Torres A, Alves PL.

Grupo de Alelopatia, Departamento de Quimica Organica, Facultad de Ciencias,
Universidad de Cadiz, 11510 Puerto Real, Spain. famacias@uca.es

Six new sesquiterpene lactones, annuolide H (3), helivypolides F, H/​J (4,
11/​13), and helieudesmanolide A (6), together with known compounds, were
isolated from polar bioactive fractions of Helianthus annuus cv. SH/​222 and
Stella fresh leaf water extracts. Spectroscopic analysis of the new data for
1,2/​anhydroniveusin A and 1/​methoxy/​4,5/​dihydroniveusin A corrects some previous
assignments. The compounds were tested using the etiolated wheat coleoptile
bioassay, and the most active compounds were assayed in standard target species
(STS) (Lepidium sativum, Allium cepa, Lactucasativa, Lycopersicon esculentum,
and Triticum aestivum) from 5 x 10(/​4) to 10(/​5) M. The most phytotoxic
compounds were helivypolide F and 15/​hydroxy/​3/​dehydrodeoxyfruticin, both of
which have a carbonyl group at C/​3 conjugated with two double bonds.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16724843 [PubMed /​ indexed for MEDLINE]

35: Cytogenet Genome Res. 2006;114(1):77/​82.

Nuclear DNA content and nuclear and cell volume are positively correlated in
angiosperms.

Jovtchev G, Schubert V, Meister A, Barow M, Schubert I.

Institute of Plant Genetics and Crop Plant Research (IPK), Gatersleben, Germany.

Volumes of flow sorted nuclei were analyzed from two highly endopolyploid
(diploids with endopolyploid tissues) species (Arabidopsis thaliana and Barbarea
stricta), from a less endopolyploid species (Allium cepa) and from two
non/​endopolyploid species (Chrysanthemum multicolor and Fritillaria uva/​vulpis).
Intraspecific as well as interspecific comparisons revealed a highly positive
correlation (r > 0.99) between DNA content and nuclear volume. No significant
differences between expected and measured nuclear volumes were noted indicating
that chromatin packing is not increased with increasing DNA content in the
tested plant species. In epidermis cells of A. thaliana, A. cepa and Ch.
multicolor, a lower (r between 0.6 and 0.7) but significant positive correlation
between nuclear volume and cell volume was found. This correlation is compatible
with the hypothesis that endopolyploidization (EP = consecutive replication
cycles not separated by nuclear and cell divisions) might speed up the growth of
endopolyploid species and compensate for small genome size. 2006 S. Karger AG,
Basel.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16717454 [PubMed /​ indexed for MEDLINE]

36: Fitoterapia. 2006 Jun;77(4):321/​3. Epub 2006 May 11.

In vitro antifungal activities of Allium cepa, Allium sativum and ketoconazole
against some pathogenic yeasts and dermatophytes.

Shams/​Ghahfarokhi M, Shokoohamiri MR, Amirrajab N, Moghadasi B, Ghajari A, Zeini
F, Sadeghi G, Razzaghi/​Abyaneh M.

Department of Mycology, Faculty of Medical Sciences, Tarbiat Modarress
University, Tehran 14115/​111, Iran. shamsm@modares.ac.ir

By using an agar dilution assay, the antifungal activity of aqueous extracts
prepared from Allium cepa (onion; AOE) and Allium sativum (garlic; AGE) were
evaluated against Malassezia furfur (25 strains), Candida albicans (18 strains),
other Candida sp. (12 strains) as well as 35 strains of various dermatophyte
species and compared with the activity of a known antifungal drug, ketoconazole
(KTZ). All the AOE, AGE and KTZ were found to be able to inhibit growth of all
fungi tested in a dose/​dependent manner with maximum of 100% at defined
concentrations. The results indicate that onion and garlic might be promising in
treatment of fungal/​associated diseases from important pathogenic genera
Candida, Malassezia and the dermatophytes.

PMID: 16690223 [PubMed /​ indexed for MEDLINE]

37: Phytother Res. 2006 Jul;20(7):581/​4.

Exploring Allium species as a source of potential medicinal agents.

Stajner D, Milic N, Canadanovic/​Brunet J, Kapor A, Stajner M, Popovic BM.

Faculty of Agriculture, University of Novi Sad, Trg Dositeja Obradovica 8, 21000
Novi Sad, Serbia and Montenegro.

It has been shown that Allium species may help to prevent tumor promotion,
cardiovascular diseases and aging; all processes that are associated with free
radicals. Therefore the Allium species of both cultivated species (Allium nutans
L., Allium fistulosum L., Allium vineale L., Allium psekemense B. Fedtsch,
Allium cepa L., Allium sativum L.) and wild species (Allium flavum L., Allium
sphaerocephalum L., Allium atroviolaceum Boiss, Allium schenoprasum L., Allium
vineale L., Allium ursinum L., Allium scorodoprasum L.) from various locations
were investigated for their antioxidative properties. The leaves were examined
for activities of antioxidative enzymes (catalase, peroxidase,
superoxide/​dismutase, glutathione/​peroxidase), non/​enzymic antioxidants (reduced
glutathione and total flavonoids), content of soluble proteins, vitamin C,
carotenoids, chlorophylls a and b, as well as the quantities of
malonyldialdehyde and *OH and O2*/​ radicals. Using a contemporary spectroscopic
fluorescent method, lipofuscin, 'plant age pigments' were determined. ESR
spectroscopy was used to follow the decrease of oxygen radicals in the presence
of extracts of Allium species in phosphate buffer (pH 7). The results showed
that all Allium species had strong antioxidative properties due to their high
concentration of total flavonoids, high content of carotenoids and chlorophylls,
and very low concentrations of toxic oxygen radicals. ESR signals of DMPO/​OH
radical adducts, in the presence of Allium extracts in phosphate buffer (pH 7),
were reduced by up to 94.3%.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16676298 [PubMed /​ in process]

38: J Agric Food Chem. 2006 May 3;54(9):3341/​50.

Effects of fertilization, crop year, variety, and provenance factors on mineral
concentrations in onions.

Ariyama K, Nishida T, Noda T, Kadokura M, Yasui A.

Center for Food Quality, Labeling and Consumer Services, 2/​1 Shintoshin,
Saitama/​shi 330/​9731, Japan. kaoru/​ariyama@cfqlcs.go.jp

Mineral concentrations of onions (Allium cepa L.) grown under various
conditions, including factors (fertilization, crop year, variety, and
provenance), were investigated to clarify how much each factor contributes to
the variation of their concentrations. This was because the mineral
concentrations might be affected by various factors. The ultimate goal of this
study was to develop a technique to determine the geographic origins of onions
by mineral composition. Samples were onions grown under various conditions at 52
fields in 18 farms in Hokkaido, Japan. Twenty/​six elements (Li, Na, Mg, Al, P,
K, Ca, Mn, Fe, Co, Ni, Cu, Zn, Rb, Sr, Y, Mo, Cd, Cs, Ba, La, Ce, Nd, Gd, W, and
Tl) in these samples were determined by inductively coupled plasma atomic
emission spectrometry and inductively coupled plasma mass spectrometry.
Fertilization conditions and crop years of onions caused variations of P, Ni,
Cu, Rb, Sr, Mo, Cs, and Tl concentrations in onions; different onion varieties
also showed variations in numerous element concentrations. However, the
variations of mineral compositions of onions by these factors were smaller than
the differences between production places with a few exceptions. Furthermore,
Na, Rb, and Cs in group IA of the periodic table, Ca, Sr, and Ba in group IIA,
and Zn and Cd in group IIB showed similar concentration patterns by group; this
result demonstrated that elements in the same periodic groups behaved similarly
in terms of their absorption in onions.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 16637694 [PubMed /​ indexed for MEDLINE]

39: J Steroid Biochem Mol Biol. 2006 May;99(2/​3):100/​7. Epub 2006 Apr 18.

Beta/​sitosterol/​3/​O/​beta/​D/​glucopyranoside: a eukaryotic DNA polymerase lambda
inhibitor.

Mizushina Y, Nakanishi R, Kuriyama I, Kamiya K, Satake T, Shimazaki N, Koiwai O,
Uchiyama Y, Yonezawa Y, Takemura M, Sakaguchi K, Yoshida H.

Laboratory of Food & Nutritional Sciences, Department of Nutritional Science,
Kobe/​Gakuin University, Kobe, Hyogo 651/​2180, Japan.
mizushin@nutr.kobegakuin.ac.jp

Beta/​sitosterol/​3/​O/​beta/​D/​glucopyranoside (compound 1), a steroidal glycoside
isolated from onion (Allium cepa L.) selectively inhibited the activity of
mammalian DNA polymerase lambda (pol lambda) in vitro. The compound did not
influence the activities of replicative DNA polymerases such as alpha, delta and
epsilon, but also showed no effect even on the activity of pol beta which is
thought to have a very similar three/​dimensional structure to the pol beta/​like
region of pol lambda. Since parts of compound 1 such as beta/​sitosterol
(compound 2) and D/​glucose (compound 3) did not influence the activities of any
enzymes tested, the converted structure of compounds 2 and 3 might be important
for pol lambda inhibition. The inhibitory effect of compound 1 on both intact
pol lambda (i.e. residues 1/​575) and a truncated pol lambda lacking the
N/​terminal BRCA1 C/​terminus (BRCT) domain (133/​575, del/​1 pol lambda) was
dose/​dependent, and 50% inhibition was observed at a concentration of 9.1 and
5.4 microM, respectively. The compound 1/​induced inhibition of del/​1 pol lambda
activity was non/​competitive with respect to both the DNA template/​primer and
the dNTP substrate. On the basis of these results, the pol lambda inhibitory
mechanism of compound 1 is discussed.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16621516 [PubMed /​ indexed for MEDLINE]

40: Rev Med Chir Soc Med Nat Iasi. 2005 Jul/​Sep;109(3):676/​9.

[Phytochemical and microbiological characterization of two Allium cepa L.
extracts in order to include in dermo/​cosmetics]

[Article in Romanian]

Tataringa G, Hancianu M, Aprotosoaie C, Poiata A, Vasilescu M, Gafitanu E.

Universitatea de Medicina si Farmacie Gr.T. Popa Iasi, Facultatea de Farmacie.

We have obtained two Allium cepa extracts (C1 and C2) which were characterized
from chemical and microbiological point of view. The C1 extract is the richest
concerning the content in flavonoids, triterpenic acids, amino acids, compounds
recognized for their beneficial effects in wound healing. All this data shows us
the possibility of using the Allium cepa extracts in the treatment of wounds,
scars. As well, the antimicrobial activity of the two extracts was evaluated.
The C2 extract was efficient as antimicrobial agent, but there are necessary
special preserving conditions.

Publication Types:
English Abstract

PMID: 16607772 [PubMed /​ indexed for MEDLINE]

41: Plant Physiol. 2006 May;141(1):196/​207. Epub 2006 Mar 31.

Identification of a vacuolar sucrose transporter in barley and Arabidopsis
mesophyll cells by a tonoplast proteomic approach.

Endler A, Meyer S, Schelbert S, Schneider T, Weschke W, Peters SW, Keller F,
Baginsky S, Martinoia E, Schmidt UG.

University of Zurich, Institute of Plant Biology, CH/​8008 Zurich, Switzerland.

The vacuole is the main cellular storage pool, where sucrose (Suc) accumulates
to high concentrations. While a limited number of vacuolar membrane proteins,
such as V/​type H(+)/​ATPases and H(+)/​pyrophosphatases, are well characterized,
the majority of vacuolar transporters are still unidentified, among them the
transporter(s) responsible for vacuolar Suc uptake and release. In search of
novel tonoplast transporters, we used a proteomic approach, analyzing the
tonoplast fraction of highly purified mesophyll vacuoles of the crop plant
barley (Hordeum vulgare). We identified 101 proteins, including 88 vacuolar and
putative vacuolar proteins. The Suc transporter (SUT) HvSUT2 was discovered
among the 40 vacuolar proteins, which were previously not reported in
Arabidopsis (Arabidopsis thaliana) vacuolar proteomic studies. To confirm the
tonoplast localization of this Suc transporter, we constructed and expressed
green fluorescent protein (GFP) fusion proteins with HvSUT2 and its closest
Arabidopsis homolog, AtSUT4. Transient expression of HvSUT2/​GFP and AtSUT4/​GFP
in Arabidopsis leaves and onion (Allium cepa) epidermal cells resulted in green
fluorescence at the tonoplast, indicating that these Suc transporters are indeed
located at the vacuolar membrane. Using a microcapillary, we selected mesophyll
protoplasts from a leaf protoplast preparation and demonstrated unequivocally
that, in contrast to the companion cell/​specific AtSUC2, HvSUT2 and AtSUT4 are
expressed in mesophyll protoplasts, suggesting that HvSUT2 and AtSUT4 are
involved in transport and vacuolar storage of photosynthetically derived Suc.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16581873 [PubMed /​ indexed for MEDLINE]

42: Ann Bot (Lond). 2006 Jun;97(6):1127/​38. Epub 2006 Mar 6.

Neutral red as a probe for confocal laser scanning microscopy studies of plant
roots.

Dubrovsky JG, Guttenberger M, Saralegui A, Napsucialy/​Mendivil S, Voigt B,
Baluska F, Menzel D.

Departamento de Biologia Molecular de Plantas, Universidad Nacional Autonoma de
Mexico, Cuernavaca, Morelos, Mexico. jdubrov@ibt.unam.mx

BACKGROUND AND AIMS: Neutral red (NR), a lipophilic phenazine dye, has been
widely used in various biological systems as a vital stain for bright/​field
microscopy. In its unprotonated form it penetrates the plasma membrane and
tonoplast of viable plant cells, then due to protonation it becomes trapped in
acidic compartments. The possible applications of NR for confocal laser scanning
microscopy (CLSM) studies were examined in various aspects of plant root
biology. METHODS: NR was used as a fluorochrome for living roots of Phaseolus
vulgaris, Allium cepa, A. porrum and Arabidopsis thaliana (wild/​type and
transgenic GFP/​carrying lines). The tissues were visualized using CLSM. The
effect of NR on the integrity of the cytoskeleton and the growth rate of
arabidopsis primary roots was analysed to judge potential toxic effects of the
dye. KEY RESULTS: The main advantages of the use of NR are related to the fact
that NR rapidly penetrates root tissues, has affinity to suberin and lignin, and
accumulates in the vacuoles. It is shown that NR is a suitable probe for
visualization of proto/​ and metaxylem elements, Casparian bands in the
endodermis, and vacuoles in cells of living roots. The actin cytoskeleton and
the microtubule system of the cells, as well as the dynamics of root growth,
remain unchanged after short/​term application of NR, indicating a relatively low
toxicity of this chemical. It was also found that NR is a useful probe for the
observation of the internal structures of root nodules and of fungal hyphae in
vesicular/​arbuscular mycorrhizas. CONCLUSIONS: Ease, low cost and absence of
tissue processing make NR a useful probe for structural, developmental and
vacuole/​biogenetic studies of plant roots with CLSM.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16520341 [PubMed /​ indexed for MEDLINE]

43: J Nutr. 2006 Mar;136(3):608/​13.

The production of reactive oxygen species and the mitochondrial membrane
potential are modulated during onion oil/​induced cell cycle arrest and apoptosis
in A549 cells.

Wu XJ, Stahl T, Hu Y, Kassie F, Mersch/​Sundermann V.

Institute of Indoor and Environmental Toxicology, Faculty of Medicine,
Justus/​Liebig/​University of Giessen, Germany.

Protective effects of Allium vegetables against cancers have been shown
extensively in experimental animals and epidemiologic studies. We investigated
cell proliferation and the induction of apoptosis by onion oil extracted from
Allium cepa, a widely consumed Allium vegetable, in human lung cancer A549
cells. GC/MS analysis suggested that propyl sulfides but not allyl sulfides are
major sulfur/​containing constituents of onion oil. Onion oil at 12.5 mg/L
significantly induced apoptosis (13% increase of apoptotic cells) as indicated
by sub/​G1 DNA content. It also caused cell cycle arrest at the G2/M phase; 25
mg/L onion oil increased the percentage of G2/M cells almost 6/​fold compared
with the dimethyl sulfoxide control. The action of onion oil may occur via a
reactive oxygen species/​dependent pathway because cell cycle arrest and
apoptosis were blocked by the antioxidants N/​acetylcysteine and exogenous
glutathione. Marked collapse of the mitochondrial membrane potential suggested
that dysfunction of the mitochondria may be involved in the oxidative burst and
apoptosis induced by onion oil. Expression of phospho/​cdc2 and phospho/​cyclin B1
were downregulated by onion oil, perhaps accounting for the G2/M arrest.
Overall, these results suggest that onion oil may exert chemopreventive action
by inducing cell cycle arrest and apoptosis in tumor cells.

PMID: 16484532 [PubMed /​ indexed for MEDLINE]

44: J Chromatogr A. 2006 Apr 21;1112(1/​2):23/​30. Epub 2006 Feb 14.

Seleno/​compounds in garlic and onion.

Arnault I, Auger J.

CRITT INNOPHYT, Universite Francois Rabelais, Parc de Grandmont, 37200 Tours,
France.

Garlic (Allium sativum) and onion (Allium cepa) are widely known for their
biological properties but are far from having revealed all of their secrets even
if the compounds involved in the biological mechanisms, flavenols, sulphur and
seleno compounds have been identified. The beneficial effect of garlic on health
including protection against cardiovascular diseases and cancers results from
all of these compounds although their individual involvement is complex. Garlic
and onion, broccoli, wild leek, have the ability to accumulate the selenium (Se)
from soil. These Se/​enriched plants present a greater protection against
carcinogenesis than the common plants and two Se/​compounds possessing
anti/​cancer activity have been identified: Se/​methyl selenocysteine and
gamma/​glutamyl/​Se/​methyl selenocysteine. However, several Se/​compounds from
Se/​enriched garlic or onion remain unidentified. The techniques for the
detection of Se/​species are numerous but few methods are able to identify the
detected compounds. The very small quantities of Se/​compounds present and the
clear lack of standards do not make their analysis straightforward, particularly
for non/​enriched samples. Over the last 10 or so years development of the
synthesis of Se/​compounds and the use of GC/​AED or EC/HPLC/​ICP/​MS have shown
considerable possibilities. These techniques have allowed advances in the
identification of Se/​compounds, some of which are analogues of S/​compounds in
plants and yeasts. When these techniques are coupled to EC/HPLC/​APCI/​MS/​MS, they
provide a lot of information about the Se/​biosynthesis in garlic. This has
allowed the preferential formation of methylated compounds in Se/​biochemistry to
be identified, in contrast to the sulphur biochemistry of the Allium spp. in
which compounds containing propenylic groups predominate. This review focuses on
the recent advances in the analytical methods of Se/​compounds in garlic and
onion and particular attention is given to the biological properties of
Se/​species identified in Se/​enriched plants.

Publication Types:
Review

PMID: 16480995 [PubMed /​ indexed for MEDLINE]

45: J Environ Biol. 2005 Oct;26(4):675/​80.

Studies of VA/​Mycorrhizal fungi associated with some weed plants in sugar mill
effluent soils.

Vani K, Kumar GS, Selvaraj T.

Department of Microbiology, Ponnaiyah Ramajayam College, Thanjavur /​ 614 904.
India. vankan@sify.com

This study is to isolate the effluent strain of VAM fungi from polluted soils of
sugar mill effluents. Analysis showed that pH and EC was more but the organic
matter is less when compared to non/​polluted soils. Even though there was low P
content that enhances the mycorrhizal infection, the percent of root
colonization was less than 75% in polluted study site. The number of VAM
propagules and its distribution were also greatly affected due to various
factors. Nine different VAM species were isolated and identified from the
polluted study site. Using Allium cepa L. as the host plant the efficiency of
the native effluent tolerant strains of VAM fungi isolated from the polluted
study site was determined. Highest growth rate, high dry weight of gram per
plant and increased growth was observed in the order of Glomus intraradices
followed by Gigaspora margarita and Glomus fasciculatum. Consequence of the
study clearly showed that Glomus intraradices was the efficient strain in sugar
mill effluent polluted areas.

Publication Types:
Comparative Study

PMID: 16459556 [PubMed /​ indexed for MEDLINE]

46: J Agric Food Chem. 2006 Feb 8;54(3):848/​52.

Model studies on precursor system generating blue pigment in onion and garlic.

Imai S, Akita K, Tomotake M, Sawada H.

Somatech Center, House Foods Corporation, 1/​4 Takanodai, Yotsukaido, Chiba
284/​0033, Japan. s/​imai@housefoods.co.jp

Reactions involved in blue/​green discoloration in a mixture of onion (Allium
cepa L.) and garlic (Allium sativum L.) were investigated. Vivid/​blue color was
successfully reproduced by using a defined model reaction system comprising only
trans/​(+)/​S/​(1/​propenyl)/​L/​cysteine sulfoxide (1/​PeCSO) from onion,
S/​allyl/​L/​cysteine sulfoxide (2/​PeCSO) from garlic, purified alliinase (EC
4.4.1.4), and glycine (or some other amino acids). Four reaction steps
identified and factors affecting the blue color formation were in good agreement
with those suggested by earlier investigators. When crude onion alliinase was
used in place of garlic alliinase, less pigment was formed. This result was
explained by a difference in the amount of thiosulfinates, colorless
intermediates termed color developers, yielded from 1/​PeCSO by these enzymes.

PMID: 16448193 [PubMed /​ indexed for MEDLINE]

47: J Agric Food Chem. 2006 Feb 8;54(3):843/​7.

Identification of two novel pigment precursors and a reddish/​purple pigment
involved in the blue/​green discoloration of onion and garlic.

Imai S, Akita K, Tomotake M, Sawada H.

Somatech Center, House Foods Corporation, 1/​4 Takanodai, Yotsukaido, Chiba
284/​0033, Japan. s/​imai@housefoods.co.jp

By using a model reaction system representing blue/​green discoloration that
occurs when purees of onion (Allium cepa L.) and garlic (Allium sativum L.) are
mixed, we isolated two pigment precursors (PPs) and a reddish/​purple pigment
(PUR/​1) and determined their chemical structures. PPs were isolated from a
heat/​treated solution containing color developer (CD) and either l/​valine or
l/​alanine, and their structures were determined as
2/​(3,4/​dimethylpyrrolyl)/​3/​methylbutanoic acid (PP/​Val), and
2/​(3,4/​dimethyl/​1H/​pyrrolyl) propanoic acid (PP/​Ala), respectively. Next, PUR/​1
was isolated from a heat/​treated solution containing PP/​Val and allicin, and its
structure was determined as
(1E)/​1/​(1/​((1S)/​1/​carboxy/​2/​methylpropyl)/​3,4/​dimethyl/​1H/​pyrrol/​2/​yl)/​prop/​1/​en
ylene/​3/​(1/​((1S)/​1/​carboxy/​2/​methylpropyl)/​3,4/​dimethyl/​1H/​pyrrol/​2/​ylidenium).
The structure of PUR/​1 suggested that PP molecules containing a 3,4/​dimethyl
pyrrole ring had been cross/​linked by an allyl group of allicin to form
conjugated pigments. While PUR/​1 is a dipyrrole compound exhibiting a
reddish/​purple color, a color shift toward blue to green can be expected as the
cross/​linking reaction continues to form, for example, tri/​ or tetrapyrrole
compounds.

PMID: 16448192 [PubMed /​ indexed for MEDLINE]

48: Environ Mol Mutagen. 2006 May;47(4):254/​9.

Quercetin reduces chromosome aberrations induced by atrazine in the Allium cepa
test.

Mastrangelo S, Tomassetti M, Carratu MR, Evandri MG, Bolle P.

Department of Pharmacology and Human Physiology, University of Bari, Italy.

Quercetin is a widely distributed plant flavonoid possessing a variety of
chemical and biological activities, including chelation, free/​radical
scavenging, and antioxidant activity. Atrazine is a selective triazine herbicide
that has been the subject of an international revision program for human and
ecological health risks because of its persistence in the environment. In a
previous study, we demonstrated that atrazine was clastogenic in the Allium cepa
test. In this present study, we investigated whether quercetin affords
protection from the chromosome breaks induced by atrazine. In a preliminary
assay, 0.1/​20 microg/ml quercetin produced no toxicity or clastogenic activity
in the Allium cepa test. Subsequently, we evaluated the effects of 0.5 and 5
microg/ml quercetin on the clastogenicity of 2.5, 5.0, and 7.5 microg/l
atrazine. Quercetin (0.5 microg/ml) significantly reduced the frequency of total
aberrations induced by 7.5 microg/l atrazine, while both concentrations of
quercetin significantly decreased the frequency of fragments induced by 7.5
microg/l atrazine. The results of this study indicate that plant flavonoids such
as quercetin may protect against the genotoxic effects of atrazine. Efforts to
understand the extent to which plant flavonoids influence the biological
activities of genotoxicants and the mechanisms involved in the interactions
could help to better discern the advantages and disadvantages of their use and
to clarify their possible protective role against pollutants. Copyright (c) 2006
Wiley/​Liss, Inc.

PMID: 16416428 [PubMed /​ indexed for MEDLINE]

49: Plant J. 2006 Feb;45(3):335/​46.

Rice plants take up iron as an Fe3+/​phytosiderophore and as Fe2+.

Ishimaru Y, Suzuki M, Tsukamoto T, Suzuki K, Nakazono M, Kobayashi T, Wada Y,
Watanabe S, Matsuhashi S, Takahashi M, Nakanishi H, Mori S, Nishizawa NK.

Department of Global Agricultural Sciences, Graduate School of Agricultural and
Life Sciences, University of Tokyo, 1/​1/​1 Yayoi, Bunkyo/​ku, Tokyo 113/​8657,
Japan.

Only graminaceous monocots possess the Strategy II iron (Fe)/​uptake system in
which Fe is absorbed by roots as an Fe3+/​phytosiderophore. In spite of being a
Strategy II plant, however, rice (Oryza sativa) contains the previously
identified Fe2+ transporter OsIRT1. In this study, we isolated the OsIRT2 gene
from rice, which is highly homologous to OsIRT1. Real/​time PCR analysis revealed
that OsIRT1 and OsIRT2 are expressed predominantly in roots, and these
transporters are induced by low/​Fe conditions. When expressed in yeast
(Saccharomyces cerevisiae) cells, OsIRT2 cDNA reversed the growth defects of a
yeast Fe/​uptake mutant. This was similar to the effect of OsIRT1 cDNA. OsIRT1/​
and OsIRT2/​green fluorescent protein fusion proteins localized to the plasma
membrane when transiently expressed in onion (Allium cepa L.) epidermal cells.
OsIRT1 promoter/​GUS analysis revealed that OsIRT1 is expressed in the epidermis
and exodermis of the elongating zone and in the inner layer of the cortex of the
mature zone of Fe/​deficient roots. OsIRT1 expression was also detected in the
ccompanion cells. Analysis using the positron/​emitting tracer imaging system
showed that rice plants are able to take up both an Fe3+/​phytosiderophore and
Fe2+. This result indicates that, in addition to absorbing an
Fe3+/​phytosiderophore, rice possesses a novel Fe/​uptake system that directly
absorbs the Fe2+, a strategy that is advantageous for growth in submerged
conditions.

PMID: 16412081 [PubMed /​ indexed for MEDLINE]

50: Theor Appl Genet. 2006 Feb;112(4):607/​17. Epub 2006 Jan 13.

Direct comparison between genomic constitution and flavonoid contents in Allium
multiple alien addition lines reveals chromosomal locations of genes related to
biosynthesis from dihydrokaempferol to quercetin glucosides in scaly leaf of
shallot (Allium cepa L.).

Masuzaki S, Shigyo M, Yamauchi N.

The United Graduate School of Agricultural Sciences, Tottori University,
680/​8553, Tottori, Japan.

The extrachromosome 5A of shallot (Allium cepa L., genomes AA) has an important
role in flavonoid biosynthesis in the scaly leaf of Allium fistulosum/​shallot
monosomic addition lines (FF+nA). This study deals with the production and
biochemical characterisation of A. fistulosum/​shallot multiple alien addition
lines carrying at least 5A to determine the chromosomal locations of genes for
quercetin formation. The multiple alien additions were selected from the
crossing between allotriploid FFA (female symbol) and A. fistulosum (male
symbol). The 113 plants obtained from this cross were analysed by a chromosome
5A/​specific PGI isozyme marker of shallot. Thirty plants were preliminarily
selected for an alien addition carrying 5A. The chromosome numbers of the 30
plants varied from 18 to 23. The other extrachromosomes in 19 plants were
completely identified by using seven other chromosome markers of shallot.
High/​performance liquid chromatography analyses of the 19 multiple additions
were conducted to identify the flavonoid compounds produced in the scaly leaves.
Direct comparisons between the chromosomal constitution and the flavonoid
contents of the multiple alien additions revealed that a flavonoid
3'/​hydroxylase (F3'H) gene for the synthesis of quercetin from kaempferol was
located on 7A and that an anonymous gene involved in the glucosidation of
quercetin was on 3A or 4A. As a result of supplemental SCAR analyses by using
genomic DNAs from two complete sets of A. fistulosum/​shallot monosomic
additions, we have assigned F3'H to 7A and flavonol synthase to 4A.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16411131 [PubMed /​ indexed for MEDLINE]

51: Theor Appl Genet. 2006 Mar;112(5):958/​67. Epub 2006 Jan 11.

Genetic mapping of a major gene affecting onion bulb fructan content.

McCallum J, Clarke A, Pither/​Joyce M, Shaw M, Butler R, Brash D, Scheffer J,
Sims I, van Heusden S, Shigyo M, Havey MJ.

New Zealand Institute for Crop and Food Research Limited, Private Bag 4704,
Christchurch, New Zealand. mccallumj@crop.cri.nz

The non/​structural dry matter content of onion bulbs consists principally of
fructose, glucose, sucrose and fructans. The objective of this study was to
understand the genetic basis for the wide variation observed in the relative
amounts of these carbohydrates. Bulb carbohydrate composition was evaluated in
progeny from crosses between high dry matter storage onion varieties and sweet,
low dry matter varieties. When samples were analysed on a dry weight basis,
reducing sugar and fructan content exhibited high negative correlations and
bimodal segregation suggestive of the action of a major gene. A polymorphic SSR
marker, ACM235, was identified which exhibited strong disequilibrium with bulb
fructan content in F(2:3) families from the 'W202A' x 'Texas Grano 438' mapping
population evaluated in two environments. This marker was mapped to chromosome 8
in the interspecific population 'Allium cepa x A. roylei'. Mapping in the
'Colossal Grano PVP' x 'Early Longkeeper P12' F2 population showed that a
dominant major gene conditioning high/​fructan content lay in the same genomic
region. QTL analysis of total bulb fructan content in the intraspecific mapping
population 'BYG15/​23' x 'AC43' using a complete molecular marker map revealed
only one significant QTL in the same chromosomal region. This locus,
provisionally named Frc, may account for the major phenotypic differences in
bulb carbohydrate content between storage and sweet onion varieties.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16404585 [PubMed /​ indexed for MEDLINE]

52: Tsitol Genet. 2005 Sep/​Oct;39(5):73/​80.

[Toxic and cytogenetic effects induced in Allium cepa with low concenrations of
Cd and 232th]

[Article in Russian]

Evseeva TI, Maistrenko TA, Geras'kin SA, Belykh ES, Kazakova EV.

232Th (7.76 x 10(/​7) M) and Cd (0.89 x 10(/​8) M) in concentrations which do not
exceed officially prescribed standards when entering with water do not increase
the frequency of chromosome aberrations in comparison with the control. Such
concentrations do not cause toxic effects in plants on the levels of tissues and
of the whole organism but they do display their activity on the cell level
damaging division spindle. Dependence "cadmium concentration/​effect" is not
linear for any type of cytogenetical damages. At the concentration of cadmium
0.89 x 10(/​7) M its influence on formation of division spindle is weakened and
the frequency of chromosome aberrations is reducing in comparison with the
control and with the effects induced at lower concentrations of cadmium in
solution (0.89 x 10(/​8) M). Cadmium in high concentration (5.34 x 10(/​5) M)
causes significant toxic and mutagenic effects.

Publication Types:
Comparative Study
English Abstract

PMID: 16398149 [PubMed /​ indexed for MEDLINE]

53: Genome. 2005 Dec;48(6):1052/​60.

Comparative genomic analyses in Asparagus.

Kuhl JC, Havey MJ, Martin WJ, Cheung F, Yuan Q, Landherr L, Hu Y, Leebens/​Mack
J, Town CD, Sink KC.

Department of Horticulture, Michigan State University, East Lansing 48824, USA.

Garden asparagus (Asparagus officinalis L.) belongs to the monocot family
Asparagaceae in the order Asparagales. Onion (Allium cepa L.) and Asparagus
officinalis are 2 of the most economically important plants of the core
Asparagales, a well supported monophyletic group within the Asparagales. Coding
regions in onion have lower GC contents than the grasses. We compared the GC
content of 3374 unique expressed sequence tags (ESTs) from A. officinalis with
Lycoris longituba and onion (both members of the core Asparagales), Acorus
americanus (sister to all other monocots), the grasses, and Arabidopsis.
Although ESTs in A. officinalis and Acorus had a higher average GC content than
Arabidopsis, Lycoris, and onion, all were clearly lower than the grasses. The
Asparagaceae have the smallest nuclear genomes among all plants in the core
Asparagales, which typically have huge genomes. Within the Asparagaceae,
European Asparagus species have approximately twice the nuclear DNA of that of
southern African Asparagus species. We cloned and sequenced 20 genomic amplicons
from European A. officinalis and the southern African species Asparagus plumosus
and observed no clear evidence for a recent genome doubling in A. officinalis
relative to A. plumosus. These results indicate that members of the genus
Asparagus with smaller genomes may be useful genomic models for plants in the
core Asparagales.

Publication Types:
Comparative Study
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 16391674 [PubMed /​ in process]

54: Ann Nutr Metab. 2006;50(2):132/​8. Epub 2006 Jan 3.

Allium vegetable diet can reduce the exercise/​induced oxidative stress but does
not alter plasma cholesterol profile in rats.

Choi EY, Cho YO.

Department of Food and Nutrition, Duksung Women's University, Seoul, Korea.

AIMS AND METHODS: This study investigated the effect of Allium vegetable intake
on the antioxidative activity and on the plasma cholesterol profile during
exercise in rats. Ninety rats were fed either a control diet or a diet with
added Allium sativum (AS), Allium cepa (AC), Allium fistulosum (AF), or Allium
tuberosum (AT) for 4 weeks and were then subdivided into three groups: before
exercise (BE), during exercise (DE), and after exercise (AE). The DE group was
exercised on a treadmill for 1 h immediately before being sacrificed. Animals in
the AE group were allowed to take a rest for 2 h after having been exercised
like the DE group. The antioxidative activity of the Allium vegetables was
evaluated with the activities of catalase in plasma and superoxide dismutase
(SOD), the ratio of reduced glutathione/oxidized glutathione (GSH/GSSG) and the
level of malondialdehyde (MDA) in liver. The plasma concentrations of
triglyceride, total cholesterol, and high/​density lipoprotein cholesterol were
also compared. RESULTS: In AS, AC, AF and AT animals, the ratios of GSH/GSSG
were significantly higher than those of the control animals in BE and AE. The
level of liver MDA was lower than that of control animals in AE. Compared to
control animals, catalase activity of AS animals was higher in BE but was lower
in AE while SOD activity of AS animals was lower in both BE and AE. Catalase
activity of AC animals was higher in BE and DE while SOD activity of AC animals
was higher in DE. There were no differences between AF and control in catalase
activities regardless of exercise. There were no differences between control
animals and AT animals in SOD activities regardless of exercise. Plasma
cholesterol profiles were not significantly different in rats fed different
Allium vegetable diets. CONCLUSION: It is suggested that Allium vegetable diets
have antioxidative activities and can reduce the oxidative stress that results
from exercise in rats but do not alter the plasma cholesterol profile. Copyright
(c) 2006 S. Karger AG, Basel.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16391468 [PubMed /​ indexed for MEDLINE]

55: J Chromatogr A. 2006 Apr 21;1112(1/​2):3/​22. Epub 2006 Jan 18.

The analysis of onion and garlic.

Lanzotti V.

Dipartimento di Scienze e Tecnologie Agroalimentari, Ambientali e
Microbiologiche, Universita del Molise, Via F. De Sanctis, I/​86100 Campobasso,
Italy. lanzotti@unimol.it

Onion (Allium cepa L.) and garlic (Allium sativum L.), among the oldest
cultivated plants, are used both as a food and for medicinal applications. In
fact, these common food plants are a rich source of several phytonutrients
recognized as important elements of the Mediterranean diet, but are also used in
the treatment and prevention of a number of diseases, including cancer, coronary
heart disease, obesity, hypercholesterolemia, diabetes type 2, hypertension,
cataract and disturbances of the gastrointestinal tract (e.g. colic pain,
flatulent colic and dyspepsia). These activities are related to the
thiosulfinates, volatile sulfur compounds, which are also responsible for the
pungent of these vegetables. Besides these low/​molecular weight compounds, onion
and garlic are characterized by more polar compounds of phenolic and steroidal
origin, often glycosilated, showing interesting pharmacological properties.
These latter compounds, compared to the more studied thiosulfinates, present the
advantages to be not pungent and more stable to cooking. Recently, there has
been an increasing scientific attention on such compounds. In this paper, the
literature about the major volatile and non/​volatile phytoconstituents of onion
and garlic has been reviewed. Particular attention was given to the different
methodology developed to perform chemical analysis, including separation and
structural elucidation.

Publication Types:
Review

PMID: 16388813 [PubMed /​ indexed for MEDLINE]

56: Ecotoxicol Environ Saf. 2007 Jan;66(1):57/​64. Epub 2005 Dec 27.

Use of plant genotoxicity bioassay for the evaluation of efficiency of algal
biofilters in bioremediation of toxic industrial effluent.

Abdel Migid HM, Azab YA, Ibrahim WM.

Botany Department, Faculty of Science, Mansoura University, Mansoura, Dakahlia
23355, Egypt. halaabdelmigid@yahoo.com

The toxicity and efficacy of an algal/​based bioremediation technology were
assessed through bioassays for ecological risk of contaminated industrial
effluents. The algal bioremoval of heavy metals was evaluated using an in vitro
approach. Phytogenotoxicity tests were conducted with Allium cepa and Vicia faba
plants to evaluate the genotoxicity of the industrial effluents before and after
treatment with different kinds of algal biofilters (BF). Root cells were exposed
for 24 h to different dilutions of both raw and treated effluent of a chemical
fertilizer factory. Three cytogenetic endpoints were used to assess the
mutagenic potencies of the industrial effluent: mitotic inhibition, mitotic
chromosome aberrations, and nuclear irregularities in interphase cells. Before
algal treatment, the industrial effluent caused strong genotoxic effects
represented by severe inhibition in mitotic activity of meristematic cells and
high frequency of both chromosome and nucleus abnormalities. After algal
treatment, the cytotoxic effects of 30% and 60% concentrations of the treated
effluent were comparable to those of 5% and 10% concentrations before treatment,
respectively, and the frequency of both chromosome and nuclear abnormalities
declined by approximately 50%. Statistical analysis of the data indicates a
significant reduction in genotoxicity associated with a remarkable reduction in
heavy metal concentrations after bioremediation by algal BF. The Allium and
Vicia genotoxicity approach was effective in monitoring bioremediated effluent
for toxicity.

Publication Types:
Evaluation Studies
Research Support, Non/​U.S. Gov't

PMID: 16376989 [PubMed /​ indexed for MEDLINE]

57: Int J Food Sci Nutr. 2005 Sep;56(6):399/​414.

Plant foods in the management of diabetes mellitus: spices as beneficial
antidiabetic food adjuncts.

Srinivasan K.

Department of Biochemistry & Nutrition, Central Food Technological Research
Institute, Mysore/​570013, India.

Diet has been recognized as a corner stone in the management of diabetes
mellitus. Spices are the common dietary adjuncts that contribute to the taste
and flavour of foods. Besides, spices are also known to exert several beneficial
physiological effects including the antidiabetic influence. This review
considers all the available information from animal experimentation as well as
clinical trials where spices, their extracts or their active principles were
examined for treatment of diabetes. Among the spices, fenugreek seeds
(Trigonella foenumgraecum), garlic (Allium sativum), onion (Allium cepa), and
turmeric (Curcuma longa) have been experimentally documented to possess
antidiabetic potential. In a limited number of studies, cumin seeds (Cuminum
cyminum), ginger (Zingiber officinale), mustard (Brassica nigra), curry leaves
(Murraya koenigii) and coriander (Coriandrum sativum) have been reported to be
hypoglycaemic.

Publication Types:
Review

PMID: 16361181 [PubMed /​ indexed for MEDLINE]

58: Biosens Bioelectron. 2006 May 15;21(11):2176/​9. Epub 2005 Dec 5.

Development of a disposable pyruvate biosensor to determine pungency in onions
(Allium cepa L.).

Abayomi LA, Terry LA, White SF, Warner PJ.

Plant Science Laboratory, Cranfield University at Silsoe, Bedfordshire MK45 4DT,
UK. l.a.terry@cranfield.ac.uk

A disposable prototype pyruvate biosensor was constructed using pyruvate oxidase
immobilised on mediated meldolas blue electrodes to determine pungency in onions
(Allium cepa L.). The optimum operating potential was +150 mV (versus Ag/AgCl).
A strong correlation between the biosensor response and untreated onion juice of
known pyruvate concentration 2/​12 micromol/g fresh weight (FW) was demonstrated.
The biosensor was able to differentiate between low and high pungency onions.
The detection limit using 1 unit of pyruvate oxidase was 1/​2 micromol/g FW.
Optimum concentrations of co/​factors TPP, FAD and MgSO4 comprising the enzyme
cocktail were determined as being 0.04, 0.1 and 30 mM, respectively.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 16330200 [PubMed /​ in process]

59: J Exp Bot. 2006;57(1):113/​24. Epub 2005 Nov 16.

CK2 phosphorylation weakens 90 kDa MFP1 association to the nuclear matrix in
Allium cepa.

Samaniego R, Jeong SY, de la Torre C, Meier I, Moreno Diaz de la Espina S.

Nuclear Matrix Laboratory, Centro de Investigaciones Biologicas, CSIC,
28040/​Madrid, Spain.

MFP1 is a conserved plant coiled/​coil protein located on the stroma side of the
chloroplast thylakoids, as well as in the nuclear matrix. It displays
species/​specific variability in the number of genes, proteins, and expression.
Allium cepa has two nuclear proteins antigenically related to MFP1 with
different M(r), pI, distribution, and expression, but only the 90 kDa MFP1
protein is a nuclear matrix component that associates with both the
nucleoskeletal filaments and a new category of nuclear bodies. The 90 kDa AcMFP1
migrates in two/​dimensional blots as two sets of spots. The hypo/​phosphorylated
forms (pI approximately 9.5) are tightly bound to the nuclear matrix, while high
ionic strength buffers release the more acidic hyper/​phosphorylated ones (pI
approximately 8.5), suggesting that the protein is post/​translationally
modified, and that these modifications control its attachment to the nuclear
matrix. Dephosphorylation by exogenous alkaline phosphatase and phosphorylation
by exogenous CK2, as well as specific inhibition and stimulation of endogenous
CK2 with heparin and spermine and spermidine, respectively, revealed that the
protein is an in vitro and in vivo substrate of this enzyme, and that CK2
phosphorylation weakens the strength of its binding to the nuclear matrix. In
synchronized cells, the nuclear 90 kDa AcMFP1 phosphorylation levels vary during
the cell cycle with a moderate peak in G2. These results provide the first
evidence for AcMFP1 in vivo phosphorylation, and open up further research on its
nuclear functions.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16291799 [PubMed /​ indexed for MEDLINE]

60: Mycol Res. 2005 Nov;109(Pt 11):1243/​9.

Andrastin A and barceloneic acid metabolites, protein farnesyl transferase
inhibitors from Penicillium albocoremium: chemotaxonomic significance and
pathological implications.

Overy DP, Larsen TO, Dalsgaard PW, Frydenvang K, Phipps R, Munro MH,
Christophersen C.

Centre for Microbial Biotechnology, Biocentrum/​DTU, Technical University of
Denmark, Kgs Lyngby, Denmark. do@biocentrum.dtu.dk

A survey of Penicillium albocoremium was undertaken to identify potential
taxonomic metabolite markers. One major and four minor metabolites were
consistently produced by the 19 strains surveyed on three different media.
Following purification and spectral studies, the metabolites were identified as
the known protein farnesyl transferase inhibitors andrastin A (1) and
barceloneic acid A (2) along with barceloneic acid B (3), barceloneic lactone
(4), and methyl barceloneate (5). These compounds are significant taxonomic
markers for P. albocoremium; moreover this is the first report of a methyl ester
of a barceloneic acid being produced as a secondary metabolite. Tissue extracts
created following pathogenicity trials involving P. albocoremium and Allium cepa
confirmed the production of these five metabolites in planta. Barceloneic acid B
was found to be biologically active against a P388 murine leukemia cell line.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16279417 [PubMed /​ indexed for MEDLINE]

61: J Agric Food Chem. 2005 Nov 16;53(23):8957/​62.

Evaluation of the cytotoxicity, genotoxicity, mutagenicity, and antimutagenicity
of propolis from Tucuman, Argentina.

Nieva Moreno MI, Zampini IC, Ordonez RM, Jaime GS, Vattuone MA, Isla MI.

Instituto de Estudios Vegetales Dr Antonio Rodolfo Sampietro, Facultad de
Bioquimica, Quimica y Farmacia, Universidad Nacional de Tucuman, Ayacucho 461,
4000 San Miguel de Tucuman, Argentina.

This study evaluates the toxic, genotoxic/mutagenic, and antimutagenic effects
of propolis extract from Amaicha del Valle, Tucuman, Argentina. The cytotoxicity
assays carried out with the lethality test of Artemia salina revealed that the
LD50 was around 100 microg/mL. Propolis extracts showed no toxicity to
Salmonella typhimurium TA98 and TA100 strains and Allium cepa at concentrations
that have antibiotic and antioxidant activities. Otherwise, for the testing
doses, neither genotoxicity nor mutagenicity was found in any sample. The
propolis extracts were able to inhibit the mutagenesis of isoquinoline (IQ) and
4/​nitro o/​phenylenediamine (NPD) with ID50 values of 40 and 20 microg/plate,
respectively. From this result, the studied propolis may be inferred to contain
some chemical compounds capable of inhibiting the mutagenicity of direct/​acting
and indirect/​acting mutagens. A compound isolated from Amaicha del Valle
propolis, 2',4'/​dihydroxychalcone, showed cytotoxic activity (LC50 values of 0.5
microg/mL) but was not genotoxic or mutagenic. Furthermore, this compound was
able to inhibit the mutagenicity of IQ (ID50 values of 1 microg/plate) but was
unable to inhibit the mutagenicity of NPD. Our results suggest a potential
anticarcinogenic activity of Amaicha del Valle propolis and the chalcone
isolated from it.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16277388 [PubMed /​ indexed for MEDLINE]

62: J Environ Qual. 2005 Oct 12;34(6):2082/​5. Print 2005 Nov/​Dec.

Antibiotic uptake by plants from soil fertilized with animal manure.

Kumar K, Gupta SC, Baidoo SK, Chander Y, Rosen CJ.

Department of Soil, Water, and Climate, University of Minnesota, St. Paul,
55108, USA. kkumar@umn.edu

Antibiotics are commonly added to animal feed as supplements to promote growth
of food animals. However, absorption of antibiotics in the animal gut is not
complete and as a result substantial amounts of antibiotics are excreted in
urine and feces that end up in manure. Manure is used worldwide not only as a
source of plant nutrients but also as a source of organic matter to improve soil
quality especially in organic and sustainable agriculture. Greenhouse studies
were conducted to determine whether or not plants grown in manure/​applied soil
absorb antibiotics present in manure. The test crops were corn (Zea mays L.),
green onion (Allium cepa L.), and cabbage (Brassica oleracea L. Capitata group).
All three crops absorbed chlortetracycline but not tylosin. The concentrations
of chlortetracycline in plant tissues were small (2/​17 ng g(/​1) fresh weight),
but these concentrations increased with increasing amount of antibiotics present
in the manure. This study points out the potential human health risks associated
with consumption of fresh vegetables grown in soil amended with antibiotic laden
manures. The risks may be higher for people who are allergic to antibiotics and
there is also the possibility of enhanced antimicrobial resistance as a result
of human consumption of these vegetables.

Publication Types:
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 16221828 [PubMed /​ indexed for MEDLINE]

63: J Agric Food Chem. 2005 Oct 19;53(21):8183/​9.

Antioxidative compounds from the outer scales of onion.

Ly TN, Hazama C, Shimoyamada M, Ando H, Kato K, Yamauchi R.

Department of Applied Life Science, Faculty of Applied Biological Sciences, and
Division of Instrumental Analysis, Life Science Research Center, Gifu
University, 1/​1 Yanagido, Gifu City, Gifu 501/​1193, Japan.

Antioxidative compounds were isolated from the methanol extract of dry outer
scales of onion (Allium cepa L.). Nine phenolic compounds (1/​9) were finally
obtained by reversed/​phase high/​performance liquid chromatography, and their
structures were elucidated by NMR and mass spectrometry analyses. They were the
six known compounds, protocatechuic acid (1),
2/​(3,4/​dihydroxybenzoyl)/​2,4,6/​trihydroxy/​3(2H)/​benzofuranone (2), quercetin
4'/​O/​beta/​D/​glucopyranoside (3), quercetin (5), 4'/​O/​beta/​d/​glucopyranoside of
quercetin dimer (7), and quercetin dimer (8), and three novel compounds,
condensation products of quercetin with protocatechuic acid (4), adduct of
quercetin with quercetin 4'/​O/​beta/​D/​glucopyranoside (6), and quercetin trimer
(9). These phenolic compounds were tested for their antioxidant properties using
autoxidation of methyl linoleate in bulk phase or free radical initiated
peroxidation of soybean phosphatidylcholine in liposomes. The flavonoid
compounds having o/​dihydroxy substituent in the B/​ring were shown to be
effective antioxidants against nonenzymic lipid peroxidation.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16218662 [PubMed /​ indexed for MEDLINE]

64: Acta Biol Hung. 2005;56(3/​4):313/​21.

The cytogenetic effects of Avenoxan on Allium cepa and its relation with pollen
sterility.

Kaymak F, Muranli FD.

Department of Biology, Faculty of Arts and Sciences, Trakya University, 22030
Edirne, Turkey. kaymakf@trakya.edu.tr

In the present study, the cytogenetic effects of the herbicide Avenoxan on
meiotic chromosomes of Allium cepa and its relation with pollen sterility were
studied. The bulbs with roots of Allium cepa were treated with a series of
concentrations (0.1%, 0.2%, 0.4%) for 3, 6, 12 and 24 h. Controls and treated
plants were shown to obtain M1 generation. All the used concentrations of the
herbicide Avenoxan and exposure periods caused distinct increase in the number
of abnormal cells when compared with the control. The type of the abnormalities
induced: chromosome stickiness, bridges, laggards, univalents, quadrivalents and
micronuclei. Avenoxan also caused pollen sterility. Increase of chromosomal
aberrations was accompained by increase in pollen sterility.

PMID: 16196206 [PubMed /​ indexed for MEDLINE]

65: J Chem Ecol. 2005 Oct;31(10):2373/​90. Epub 2005 Sep 28.

Roquefortine/oxaline biosynthesis pathway metabolites in Penicillium ser.
Corymbifera: in planta production and implications for competitive fitness.

Overy DP, Nielsen KF, Smedsgaard J.

Center for Microbial Biotechnology, Technical University of Denmark,
BioCentrum/​DTU, Building 221, DK/​2800 Kgs. Lyngby, Denmark. do@biocentrum.dtu.dk

Three strains of each of the seven taxa comprising the Penicillium series
Corymbifera were surveyed by direct injection mass spectrometry (MS) and liquid
chromatography/​MS for the production of terrestric acid and roquefortine/oxaline
biosynthesis pathway metabolites when cultured upon macerated tissue agars
prepared from Allium cepa, Zingiber officinale, and Tulipa gesneriana, and on
the defined medium Czapek yeast autolysate agar (CYA). A novel solid/​phase
extraction methodology was applied for the rapid purification of roquefortine
metabolites from a complex matrix. Penicillium hordei and P. venetum produced
roquefortine D and C, whereas P. hirsutum produced roquefortine D and C and
glandicolines A and B. P. albocoremium, P. allii, and P. radicicola carried the
pathway through to meleagrin, producing roquefortine D and C, glandicolines A
and B, and meleagrin. P. tulipae produced all previously mentioned metabolites
yet carried the pathway through to an end product recognized as epi/​neoxaline,
prompting the proposal of a roquefortine/epi/​neoxaline biogenesis pathway.
Terrestric acid production was stimulated by all Corymbifera strains on
plant/​derived media compared to CYA controls. In planta, production of
terrestric acid, roquefortine C, glandicolines A and B, meleagrin,
epi/​neoxaline, and several other species/​related secondary metabolites were
confirmed from A. cepa bulbs infected with Corymbifera strains. The deposition
of roquefortine/oxaline pathway metabolites as an extracellular nitrogen reserve
for uptake and metabolism into growing mycelia and the synergistic role of
terrestric acid and other Corymbifera secondary metabolites in enhancing the
competitive fitness of Corymbifera species in planta are proposed.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 16195849 [PubMed /​ indexed for MEDLINE]

66: Biocell. 2005 Aug;29(2):169/​76.

DNA injury induced by 5/​aminouracil and caffeine in G2 checkpoints path of
higher plant cells.

Del Campo A, Bracho M, Marcano L, Guinez J, De la Torre C.

Universidad del Zulia, Facultad Experimental de Ciencias, Departamento de
Biologia, Maracaibo, Estado Zulia, Venezuela. delcampoa@terra.com

This work evaluated the qualitative and quantitative cellular changes induced by
treatment with 5/​aminouracil (5/​AU) and a combination of 5/​AU and caffeine in
plant cells in relation to DNA damage, repaired damage, and residual damage. As
biological material, Allium cepa L. root tips were used, grown in filtered
water, in darkness, with aeration at constant temperature of 25 degrees C +//​
0.5. Cell populations were synchronized using 5 mM caffeine in order to study
the effects of 5/​AU and caffeine/5/​AU combined treatment on the DNA content and
their incidence in the entrance to mitosis. The results showed a delay in the G2
period due to induced DNA damage by the 5/​AU and caffeine/5/​AU combined
treatment, shown by aberrant metaphases, anaphases and telophases. The effect of
caffeine in the combined treatment was heightened in spite of lengthening the
checkpoints route that retains the cells in G2. The existence of G2 checkpoints
was shown in the cell population studied, inducing lesions in the DNA,
chromosomic aberrations and cellular instability.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16187495 [PubMed /​ indexed for MEDLINE]

67: Phytother Res. 2005 Jul;19(7):633/​42.

The use of health foods, spices and other botanicals in the Sikh community in
London.

Sandhu DS, Heinrich M.

Centre for Pharmacognosy and Phytotherapy, The School of Pharmacy, University of
London, 29/​39 Brunswick Square, London WC1N 1AX, UK.

Attitudes and practice concerning complementary and alternative medicine (CAM)
are currently an area of considerable interest. However, little is known about
the overall importance of such practices, for example, in immigrant communities
such as the Sikh (Punjabi) British. The use of CAM in immigrants belonging to
the Sikh religion in London was studied. The primary objective was to analyse
the extent to which traditional medicine is used and understood by this
population. Traditional Sikh medicine is important to this group of informants
and a total of 42 species were recorded and identified tentatively. The most
frequently mentioned species were Allium cepa (onion /​/​ gunda), Allium sativum
(garlic /​/​ lasan, thon), Capsicum frutescens (cayenne pepper /​/​ lalmirch),
Cinnamomum verum (cinnamom/​/​dhal chini), Citrus limon (lemon /​/​ nimbu),
Foeniculum vulgare (fennel /​/​ saunf), Elettaria cardamomum (cardamom /​/​ elaichi)
and Zingiber officinale (ginger /​/​ adrak). The study also highlights the rapid
change this tradition is undergoing in a diaspora situation.In depth studies on
the use of CAM among other immigrant communities and among ethnic groups are
urgent and may help to manage better the treatment of minor ailments as well as
chronic diseases. Specifically, more research on traditional and herbal remedies
amongst the numerous ethnic groups in urban Britain and how this impacts on the
use of biomedicine (e.g. as it is provided by the NHS) is essential.

PMID: 16161027 [PubMed /​ indexed for MEDLINE]

68: Transgenic Res. 2005 Jun;14(3):261/​72.

Two different Bacillus thuringiensis toxin genes confer resistance to beet
armyworm (Spodoptera exigua Hubner) in transgenic Bt/​shallots (Allium cepa L.).

Zheng SJ, Henken B, de Maagd RA, Purwito A, Krens FA, Kik C.

Plant Research International, Wageningen University and Research Center, P O Box
16, 6700 AA Wageningen, The Netherlands.

Agrobacterium/​mediated genetic transformation was applied to produce beet
armyworm (Spodoptera exigua Hubner) resistant tropical shallots (Allium cepa L.
group Aggregatum). A cry1Ca or a H04 hybrid gene from Bacillus thuringiensis,
driven by the chrysanthemum ribulose/​1,5/​bisphosphate carboxylase/oxygenase
small subunit (Rubisco SSU) promoter, along with the hygromycin
phosphotransferase gene (hpt) driven by the CaMV 35S promoter, was employed for
genetic transformation. An average transformation frequency of 3.68% was
obtained from two shallot cultivars, Tropix and Kuning. After transfer of the in
vitro plants to the greenhouse 69% of the cry1Ca and 39% of the H04 transgenic
shallots survived the first half year. After one year of cultivation in the
greenhouse the remaining cry1Ca and H04 transgenic plants grew vigorously and
had a normal bulb formation, although the cry1Ca transgenic plants (and
controls) had darker green leaves compared to their H04 counterparts. Standard
PCR, adaptor ligation PCR and Southern analyses confirmed the integration of
T/​DNA into the shallot genome. Northern blot and ELISA analyses revealed
expression of the cry1Ca or H04 gene in the transgenic plants. The amount of
Cry1Ca expressed in transgenic plants was higher than the expression levels of
H04 (0.39 vs. 0.16% of the total soluble leaf proteins, respectively). There was
a good correlation between protein expression and beet armyworm resistance.
Cry1Ca or H04 gene expression of at least 0.22 or 0.08% of the total soluble
protein in shallot leaves was sufficient to give a complete resistance against
beet armyworm. This confirms earlier observations that the H04 toxin is more
toxic to S. exigua than the Cry1Ca toxin. The results from this study suggest
that the cry1Ca and H04 transgenic shallots developed could be used for
introducing resistance to beet armyworm in (sub) tropical shallot.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16145834 [PubMed /​ in process]

69: Plant Physiol. 2005 Sep;139(1):151/​62. Epub 2005 Aug 19.

An auxilin/​like J/​domain protein, JAC1, regulates phototropin/​mediated
chloroplast movement in Arabidopsis.

Suetsugu N, Kagawa T, Wada M.

Division of Photobiology, National Institute for Basic Biology, Okazaki, Japan.

The ambient/​light conditions mediate chloroplast relocation in plant cells.
Under the low/​light conditions, chloroplasts accumulate in the light
(accumulation response), while under the high/​light conditions, they avoid the
light (avoidance response). In Arabidopsis (Arabidopsis thaliana), the
accumulation response is mediated by two blue/​light receptors, termed
phototropins (phot1 and phot2) that act redundantly, and the avoidance response
is mediated by phot2 alone. A mutant, J/​domain protein required for chloroplast
accumulation response 1 (jac1), lacks the accumulation response under weak blue
light but shows a normal avoidance response under strong blue light. In
dark/​adapted wild/​type cells, chloroplasts accumulate on the bottom of cells.
Both the jac1 and phot2 mutants are defective in this chloroplast movement in
darkness. Positional cloning of JAC1 reveals that this gene encodes a J/​domain
protein, resembling clathrin/​uncoating factor auxilin at its C terminus. The
amounts of JAC1 transcripts and JAC1 proteins are not regulated by light and by
phototropins. A green fluorescent protein/​JAC1 fusion protein showed a similar
localization pattern to green fluorescent protein alone in a transient
expression assay using Arabidopsis mesophyll cells and onion (Allium cepa)
epidermal cells, suggesting that the JAC1 protein may be a soluble cytosolic
protein. Together, these results suggest that JAC1 is an essential component of
phototropin/​mediated chloroplast movement.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16113208 [PubMed /​ indexed for MEDLINE]

70: J Environ Qual. 2005 Aug 9;34(5):1455/​60. Print 2005 Sep/​Oct.

Environmental implications of adopting a dominant factor approach to salinity
management.

Shani U, Ben/​Gal A, Dudley LM.

Department of Soil and Water Sciences, Faculty of Agricultural, Food and
Environmental Sciences, The Hebrew University of Jerusalem, P.O. Box 12, Rehovot
76100, Israel.

Additive or multiplicative models of crop response on which salinity management
theory have been developed may lead to an erroneous perception regarding
compensative interaction among salinity and other growth factors. We present
results from studies of biomass production and transpiration of corn (Zea mays
L. cv. Jubilee), melon (Cucumis melo L. subsp. melo cv. Galia), tomato
(Lycopersicon esculentum Mill. cv. 5656), onion (Allium cepa L. cv. HA 944), and
date palms (Phoenix dactylifera L. cv. Medjool) under salinity combined with
water or nitrate (growth promoters) or with boron (growth inhibitor). The
measured crop responses were to the more severe stress rather than to
combinations of the individual effects of the various stresses. Consequences of
shifting management of saline water to a dominant factor approach include
reduction of environmental contamination and conservation of water resources.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 16091597 [PubMed /​ indexed for MEDLINE]

71: Nutr Cancer. 2005;52(1):49/​58.

Induction of NAD(P)H quinone oxidoreductase by vegetables widely consumed in
Catalonia, Spain.

Laso N, Mas S, Lafuente MJ, Llobet JM, Molina R, Ballesta A, Kensler TW,
Lafuente A.

Departamento de Farmacologia y Quimica Terapeutica, IDIBAPS, Facultad de
Medicina, Universidad de Barcelona, Spain.

Monofunctional inducers (MIs) enhance phase 2 enzymes such as
nicotinamide/​adenine/​dinucleotide/​phosphate [NAD(P)H] quinone oxidoreductase
(NQO1) without modifying oxidation enzymes. The induction of these protective
enzymes appears to be mediated by genetic regulatory elements in their promoter
regions known as the antioxidant response element (ARE). The aim of this study
was to identify, through an in vitro study, which of the 30 fruits and
vegetables commonly consumed in Catalonia, Spain, contain MIs of NQO1. We
assayed the capacity of extracts of these fruits and vegetables to induce NQO1
[by more than 1.5/​fold: ratio of induction (cells treated/control) >1.5, 8/​mg/ml
dose] in two murine hepatoma cell lines: Hepa 1c1c7 and BPrC1, a modified cell
line that possesses a nonfunctional aryl hydrocarbon receptor nuclear
translocator system and is thus nonresponsive to bifunctional inducers. We also
used a third cell line, papiloma (PE) murine keratinocytes, a stably transfected
cell line with an ARE/​luc+ plasmid (AREPE cell line) for verifying induction
through the ARE with a simple luminescence screening assay. Broccoli (Hepa
1c1c7, ratio=5.5; BPrC1, ratio=2.3), calcot (Allium cepa L.) (Hepa 1c1c7,
ratio=4.7; BPrC1, ratio=.5), green onion (Hepa 1c1c7, ratio=4.6; BPrC1,
ratio=2), green cabbage (Hepa 1c1c7, ratio=3.6; BPrC1, ratio=2.7), purple
cabbage (Hepa 1c1c7, ratio=3.4; BPrC1, ratio=2), and black cabbage (Hepa 1c1c7,
ratio=3; BPrC1, ratio=3) were active NQO1 inducers in both murine hepatoma cell
lines. Extracts from broccoli (ratio=3.5), calcot (ratio=4.8), cauliflower
(ratio=4.2), cabbage (ratio=2.2), green onion (ratio=3.2), green cabbage
(ratio=3.6), black cabbage (ratio=4.5), and purple cabbage (ratio=3.7) were
confirmed to contain MIs in the AREPE cell line. These results are very similar
to those described for vegetables consumed in the United States, with the
exception of calcot, which is common in Catalonia but is not grown or consumed
widely in the United States.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16091004 [PubMed /​ indexed for MEDLINE]

72: Chemosphere. 2006 Jan;62(4):527/​37. Epub 2005 Aug 8.

Allium cepa derived EROD as a potential biomarker for the presence of certain
pesticides in water.

Fatima RA, Ahmad M.

Department of Biochemistry, Faculty of Life Sciences, AMU, Aligarh 202002,
India.

Allium cepa root length inhibition test is a well recommended bioassay for the
evaluation of the toxicity of various polluted waters. The utility of EROD
(7/​ethoxy resorufin O/​deethylase) as a potential biomarker of pesticide
pollution was investigated using the Allium cepa system. Onion bulbs exposed to
model water samples containing any of the six pesticides viz. 2,4/​D, HCB,
malathion, carbaryl, DDT and endosulphan were analyzed for EROD activity. The
pesticide treatment resulted in the enhanced activity of the enzyme, with
carbaryl and HCB causing 63/​ and 53/​fold induction respectively with respect to
the control at a dose of 1.2 ppb. The industrial wastewater samples from
Ghaziabad city of Northern India resulted in about a 68/​fold rise in the EROD
activity, whereas the Aligarh samples did not exhibit any change within the
statistical limit. These results suggest the presence of the test pesticides in
the Ghaziabad sample and their absence in the Aligarh sample. Pesticide analysis
in the test water samples by HPLC supported this to a large extent. Presence of
cycloheximide in the test system brought down the EROD activity, equal to that
of control, suggesting the de novo synthesis of the enzyme following the
exposure of Allium cepa to pesticides. These studies suggest that the Allium
cepa derived EROD can act as a potential biomarker of certain pesticides since
even 1ppb of total/individual pesticides brought about >10/​fold induction of
EROD. We recommend the assay of EROD in the Allium cepa system as a presumptive
test for the detection of these pesticides before using analytical techniques
like HPLC.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16085274 [PubMed /​ indexed for MEDLINE]

73: Sci Total Environ. 2005 Jul 15;347(1/​3):46/​52.

Comparative biomonitoring of leachates from hazardous solid waste of two
industries using Allium test.

Chandra S, Chauhan LK, Murthy RC, Saxena PN, Pande PN, Gupta SK.

Cell Biology Section, Industrial Toxicology Research Centre, P.O. Box 80, M. G.
Marg, Lucknow 226 001, India.

Hazardous industrial wastes are inevitable source of environmental pollution.
Leachates from these wastes might contaminate the origins of potable water and
affect human health. The study was carried out to determine the possible
genotoxic effects of leachates from solid waste of a metal and dye industry
using the Allium cepa chromosome aberrations assay. The 10% leachates were
prepared from solid wastes obtained from both the industries and examined for
the presence of heavy metal content and genotoxicity. To simulate the field and
laboratory conditions, A. cepa bulbs were exposed through soil and aqueous
medium for 48 h to 2.5/​10% leachates. The results revealed that both metal waste
leachate (MWL) and dye waste leachate (DWL) contained high concentrations of
chromium, nickel and iron that significantly induced cytogenetic alterations.
Significant inhibition of mitotic index (MI), inductions of chromosomal/mitotic
aberrations (CA/MA) and micronuclei (MN) formation were found in all
experimental groups exposed to MWL and DWL. The effects observed were
concentration dependent and the frequency of aberrations was higher with
treatment of MWL than DWL. The MI was severely inhibited at 10% aqueous exposure
it was 4.59+//​0.69 (P<0.001) in MWL and almost half to that induced by DWL that
was 8.62+//​0.69 (P<0.05). Significant frequency of CA/MA and MN induced by MWL
was 14.21 (P<0.001) and 0.33 (P<0.001) whereas CA/MA and MN induced by DWL was
7.81 (P<0.001) and 0.13 (P<0.05) in the aqueous medium. The investigations
inferred that abnormalities caused by MWL were higher than DWL both in soil and
aqueous media. These toxic responses may have relied on raised heavy metal
concentrations of metal/​based than dye industrial wastes.

PMID: 16084966 [PubMed /​ indexed for MEDLINE]

74: J Egypt Soc Parasitol. 2005 Aug;35(2):511/​23.

Effect of Nigella sativa and Allium cepa oils on Trichinella spiralis in
experimentally infected rats.

Abu El Ezz NM.

Department of Parasitology and Animal Diseases, National Research Center, Dokki,
Giza, Egypt.

Prophylactic and therapeutic effect of two oils had been carried out either
prior to infection or postinfection respectively in rats. Each rat in either
case was orally administered with N. sativa oil or A. cepa oil in a dose 5 mg/kg
body weight/day for 2 weeks. Assessment of results was by: (1) adult worm count
in the intestine on 7th and 20th day post infection. (2) larval count in the
muscles on the 60th day post infection. (3) Index of reproductive capacity. (4)
Detection of antibodies against T. spiralis larvae by using ELISA. The results
showed that, N. sativa oil as prophylactic treatment prior to T. spiralis
infection is more effective than A. cepa oil on both adult worms and muscle
larval count. While, A. cepa oil was showed more effectiveness than N. sativa on
decline number of adult worms and muscle larvae when used as therapeutic
treatment post infection. The level of antibody was recorded early in the groups
that treated with N. sativa oil. In conclusion, N. sativa and A. cepa oils have
anthelmintic effect in the rats infected with T. spiralis infection and
increased the production of antibodies generated during life cycle of this
parasite.

PMID: 16083064 [PubMed /​ indexed for MEDLINE]

75: Plant Physiol. 2005 Aug;138(4):1947/​56. Epub 2005 Jul 22.

Molecular identification and characterization of the Arabidopsis
delta(3,5),delta(2,4)/​dienoyl/​coenzyme A isomerase, a peroxisomal enzyme
participating in the beta/​oxidation cycle of unsaturated fatty acids.

Goepfert S, Vidoudez C, Rezzonico E, Hiltunen JK, Poirier Y.

Departement de Biologie Moleculaire Vegetale, Batiment de Biologie, Universite
de Lausanne, CH/​1015 Lausanne, Switzerland.

Degradation of unsaturated fatty acids through the peroxisomal beta/​oxidation
pathway requires the participation of auxiliary enzymes in addition to the
enzymes of the core beta/​oxidation cycle. The auxiliary enzyme
delta(3,5),delta(2,4)/​dienoyl/​coenzyme A (CoA) isomerase has been well studied
in yeast (Saccharomyces cerevisiae) and mammals, but no plant homolog had been
identified and characterized at the biochemical or molecular level. A candidate
gene (At5g43280) was identified in Arabidopsis (Arabidopsis thaliana) encoding a
protein showing homology to the rat (Rattus norvegicus)
delta(3,5),delta(2,4)/​dienoyl/​CoA isomerase, and possessing an enoyl/​CoA
hydratase/isomerase fingerprint as well as aspartic and glutamic residues shown
to be important for catalytic activity of the mammalian enzyme. The protein,
named AtDCI1, contains a peroxisome targeting sequence at the C terminus, and
fusion of a fluorescent protein to AtDCI1 directed the chimeric protein to the
peroxisome in onion (Allium cepa) cells. AtDCI1 expressed in Escherichia coli
was shown to have delta(3,5),delta(2,4)/​dienoyl/​CoA isomerase activity in vitro.
Furthermore, using the synthesis of polyhydroxyalkanoate in yeast peroxisomes as
an analytical tool to study the beta/​oxidation cycle, expression of AtDCI1 was
shown to complement the yeast mutant deficient in the
delta(3,5),delta(2,4)/​dienoyl/​CoA isomerase, thus showing that AtDCI1 is also
appropriately targeted to the peroxisome in yeast and has
delta(3,5),delta(2,4)/​dienoyl/​CoA isomerase activity in vivo. The AtDCI1 gene is
expressed constitutively in several tissues, but expression is particularly
induced during seed germination. Proteins showing high homology with AtDCI1 are
found in gymnosperms as well as angiosperms belonging to the Monocotyledon or
Dicotyledon classes.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 16040662 [PubMed /​ indexed for MEDLINE]

76: Mol Genet Genomics. 2005 Oct;274(3):197/​204. Epub 2005 Oct 20.

Genetic mapping of expressed sequences in onion and in silico comparisons with
rice show scant colinearity.

Martin WJ, McCallum J, Shigyo M, Jakse J, Kuhl JC, Yamane N, Pither/​Joyce M,
Gokce AF, Sink KC, Town CD, Havey MJ.

Agricultural Research Service, USDA, Department of Horticulture, University of
Wisconsin, Madison, 53706, USA. mjhavey@wisc.edu

The Poales (which include the grasses) and Asparagales [which include onion
(Allium cepa L.) and other Allium species] are the two most economically
important monocot orders. Enormous genomic resources have been developed for the
grasses; however, their applicability to other major monocot groups, such as the
Asparagales, is unclear. Expressed sequence tags (ESTs) from onion that showed
significant similarities (80% similarity over at least 70% of the sequence) to
single positions in the rice genome were selected. One hundred new genetic
markers developed from these ESTs were added to the intraspecific map derived
from the BYG15/​23xAC43 segregating family, producing 14 linkage groups
encompassing 1,907 cM at LOD 4. Onion linkage groups were assigned to
chromosomes using alien addition lines of Allium fistulosum L. carrying single
onion chromosomes. Visual comparisons of genetic linkage in onion with physical
linkage in rice revealed scant colinearity; however, short regions of
colinearity could be identified. Our results demonstrate that the grasses may
not be appropriate genomic models for other major monocot groups such as the
Asparagales; this will make it necessary to develop genomic resources for these
important plants.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 16025250 [PubMed /​ indexed for MEDLINE]

77: Nat Prod Rep. 2005 Jun;22(3):351/​68. Epub 2005 May 10.

Bioactive S/​alk(en)yl cysteine sulfoxide metabolites in the genus Allium: the
chemistry of potential therapeutic agents.

Rose P, Whiteman M, Moore PK, Zhu YZ.

Department of Biochemistry, National University of Singapore, 8 Medical Drive,
Singapore, 117597. bchpcr@nus.edu.sg

S/​Alk(en)yl cysteine sulfoxides are odourless, non/​protein sulfur amino acids
typically found in members of the family Alliaceae and are the precursors to the
lachrymatory and flavour compounds found in the agronomically important genus
Allium. Traditionally, Allium species, particularly the onion (Allium cepa) and
garlic (A. sativum), have been used for centuries in European, Asian and
American folk medicines for the treatment of numerous human pathologies, however
it is only recently that any significant progress has been made in determining
their mechanisms of action. Indeed, our understanding of the role of Allium
species in human health undoubtedly comes from the combination of several
academic disciplines including botany, biochemistry and nutrition. During tissue
damage, S/​alk(en)yl cysteine sulfoxides are converted to their respective
thiosulfinates or propanethial/​S/​oxide by the action of the enzyme alliinase (EC
4.4.1.4). Depending on the Allium species, and under differing conditions,
thiosulfinates can decompose to form additional sulfur constituents including
diallyl, methyl allyl, and diethyl mono/​, di/​, tri/​, tetra/​, penta/​, and
hexasulfides, the vinyldithiins and (E)/​ and (Z)/​ajoene. Recent reports have
shown onion and garlic extracts, along with several principal sulfur
constituents, can induce phase II detoxification enzymes like
glutathione/​S/​transferases (EC 2.5.1.18) and quinone reductase (QR) NAD(P)H:
(quinine acceptor) oxidoreductase (EC 1.6.99.2) in mammalian tissues, as well as
also influencing cell cycle arrest and apoptosis in numerous in vitro cancer
cell models. Moreover, studies are also beginning to highlight a role of
Allium/​derived sulfur compounds in cardiovascular protection. In this review, we
discuss the chemical diversity of S/​alk(en)yl cysteine sulfoxide metabolites in
the context of their biochemical and pharmacological mechanisms.

Publication Types:
Review

PMID: 16010345 [PubMed /​ indexed for MEDLINE]

78: New Phytol. 2005 Aug;167(2):571/​8.

Polyphosphate dynamics in mycorrhizal roots during colonization of an arbuscular
mycorrhizal fungus.

Ohtomo R, Saito M.

National Institute of Livestock and Grassland Science, 768 Senbon/​matsu,
Nasu/​shiobara, Tochigi, 329/​2793 Japan. rotm@affrc.go.jp

Inorganic polyphosphate (poly P) has been considered to be a translocatable form
of phosphate (Pi) in arbuscular mycorrhizal fungi (AMF). Here we examined
time/​course changes in poly P content during the AMF colonization process. Onion
(Allium cepa) plants were cultured with or without inoculation with Gigaspora
margarita for 2/​8 wk with periodic sampling. Poly P in the extracts, purified
through gel filtration, was quantified by the reverse reaction of polyphosphate
kinase. The length of poly P in mycorrhizal roots appeared to be shorter than in
extraradical hyphae or in spores of the AMF, indicating that AMF depolymerize
poly P before providing Pi to the host. The poly P content increased as
colonization proceeded, and was highly correlated with the weight of the
colonized roots. These results support the model that AMF supply Pi to the host
through the poly P pool, and that the poly P content of a mycorrhizal root can
be a good indicator of the Pi/​supplying activity of AMF. Copyright New
Phytologist (2005).

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15998407 [PubMed /​ indexed for MEDLINE]

79: Sci Total Environ. 2005 Jun 15;346(1/​3):256/​73.

Certain antioxidant enzymes of Allium cepa as biomarkers for the detection of
toxic heavy metals in wastewater.

Fatima RA, Ahmad M.

Department of Biochemistry, Faculty of Life Sciences, AMU, Aligarh 202002,
India.

The utility of antioxidant enzymes, viz glutathione/​S/​transferase (GST),
glutathione reductase (GR), superoxide dismutase (SOD), catalase (CAT),
ascorbate peroxidase (APX), glutathione peroxidase (GPX), monodehydroascorbate
reductase (MDHAR) and dehydroascorbate reductase (DHAR), as biomarkers of heavy
metal pollution in water was investigated using the Allium cepa (onion) system.
These antioxidant enzymes were assayed in onion bulbs exposed to certain heavy
metals taken separately, the test metals taken in combination as well as the
industrial wastewater especially found to contain these metals. GST exhibited
significantly enhanced activity upon treatment with individual heavy metals.
However, GR, SOD and CAT did not show such a pronounced increase in activities.
At higher heavy metal concentrations, GR, SOD and CAT showed a steep decline
while GST activity still showed a rise. Moreover, APX, GPX and MDHAR also
exhibited remarkable induction with increase in the concentration of individual
heavy metals. However, there was no significant change in DHAR activity with
respect to the controls. Metabolites like ascorbate (ASC) and glutathione (GSH)
exhibited significant decline with increase in the concentration of individual
heavy metals while the level of H(2)O(2) continued to display the rise up to a
heavy metal concentration of 100 microM, after which it showed a gradual
decline. A. cepa bulbs treated with wastewater sample showed enzyme activity
profiles similar to that shown with heavy metals, thereby suggesting the
presence of heavy metals in the test wastewater. Atomic absorption
spectrophotometry also detected large amounts of Cd, Cr, Cu, Hg, Pb and Zn in
the test water sample. The metal mixture, containing the amounts of heavy metals
equivalent to those found in the wastewater, resulted in steep declines in GR,
SOD and CAT activities in A. cepa while GST showed a rise. However, when this
metal mixture was diluted to 2000/​fold, GR, SOD and CAT also showed enhanced
activities compared with the controls. Contrary to the above finding, APX, GPX
and MDHAR exhibited the rise in activities in A. cepa exposed to the metal
mixture at all dilutions. In the presence of cycloheximide, all the enzymes
returned to the levels of untreated controls while chloramphenicol did not have
any effect on the test enzymes, thereby suggesting de novo protein synthesis of
the test antioxidant enzymes in the cytosolic compartment of the cell as a
result of exposure to the heavy metals.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15993699 [PubMed /​ indexed for MEDLINE]

80: Phytochemistry. 2005 Jun;66(12):1407/​16.

Molecular and biochemical characterisation of a serine acetyltransferase of
onion, Allium cepa (L.).

McManus MT, Leung S, Lambert A, Scott RW, Pither/​Joyce M, Chen B, McCallum J.

Institute of Molecular BioSciences, Massey University, Private Bag 11222,
Palmerston North, New Zealand. M.T.McManus@massey.ac.nz

We have previously cloned a cDNA, designated SAT1, corresponding to a gene
coding for a serine acetyltransferase (SAT) from onion (Allium cepa L.). The
SAT1 locus was mapped to chromosome 7 of onion using a single/​stranded
conformation polymorphism (SSCP) in the 3' UTR of the gene. Northern analysis
has demonstrated that expression of the SAT1 gene is induced in leaf tissue in
response to low S/​supply. Phylogenetic analysis has placed SAT1 in a strongly
supported group (100% bootstrap) that comprises sequences that have been
characterised biochemically, including Allium tuberosum, Spinacea oleracea,
Glycine max, Citrullus vulgaris, and SAT5 (AT5g56760) of Arabidopsis thaliana.
This group can be divided further with the SAT1 of A. cepa sequence grouping
strongly with the A. tuberosum sequence. Translation of SAT1 from onion
generates a protein of 289 amino acids with a calculated molecular mass of
30,573 Da and pI of 6.52. The conserved G277 and H282 residues that have been
identified as critical for L/​cysteine inhibition are observed at G272 and H277.
SAT1 has been cloned into the pGEX plasmid, expressed in E. coli and SAT
activity of the recombinant enzyme has been measured as acetyl/​CoA hydrolysis
detected at 232 nm. A Km of 0.72 mM was determined for l/​serine as substrate, a
Km of 92 microM was calculated with acetyl/​CoA as substrate, and an inhibition
curve for L/​cysteine generated an IC50 value of 3.1 microM. Antibodies raised
against the recombinant SAT1 protein recognised a protein of ca. 33 kDa in whole
leaf onion extracts. These properties of the SAT1 enzyme from onion are compared
with other SAT enzymes characterised from closely related species.

PMID: 15949827 [PubMed /​ indexed for MEDLINE]

81: Bioresour Technol. 2005 Nov;96(17):1867/​71.

Bioremediation of municipal sludge by vermitechnology and toxicity assessment by
Allium cepa.

Srivastava R, Kumar D, Gupta SK.

Industrial Toxicology Research Centre, P.O. Box 80, M.G. Marg, Lucknow 226 001,
India.

The aim of this study was to evaluate municipal sludge (MS) for its toxic
potential by Allium cepa and also to understand the effect of vermicomposting on
the reduction of toxicity, if any. Municipal sludge (MS) and vermicomposted
sludge (VS) were evaluated. Elemental analysis of MS showed the presence of
heavy metals. Morphological studies of A. cepa roots indicated coiled and wavy
roots on exposure to MS but no root abnormality was reported in VS. Under
genotoxic studies, inhibition in mitotic index was concentration dependent and
the control values of 11.76 gradually reduced to 5.40 at 10% MS leachate whereas
mitotic index was increased to 9.48 at 10% VS leachate. Exposure of leachate
induced chromosomal aberrations, micronucleus formation and binucleate cells in
a dose dependent manner. However, mitotic aberrations were observed significant
at 10% MS leachate but they were insignificant at 10% VS leachate. The wet and
dry weight of roots, root elongation and chlorophyll contents were reduced as
the concentration of leachate increased but VS leachate did not produce
considerable reduction. The wet and dry weight of A. cepa roots were 20.312 g
and 3.250 g respectively and they were reduced to 10.82 g and 1.68 g
respectively at 10% MS leachate but VS leachate showed an increase to 18.127 g
and 2.53 g respectively. Total chlorophyll in control, 10% MS leachate and 10%
VS leachate were 0.245 g, 0.162 g and 0.214 g respectively. It could be
concluded that the MS was toxic to a remarkable extent but vermicomposting of
sludge might be beneficial for bioremediation and recommended before land
filling.

PMID: 15927461 [PubMed /​ indexed for MEDLINE]

82: J Agric Food Chem. 2005 Jun 1;53(11):4388/​92.

Fumigant activity of plant essential oils and components from garlic (Allium
sativum) and clove bud (Eugenia caryophyllata) oils against the Japanese termite
(Reticulitermes speratus Kolbe).

Park IK, Shin SC.

Division of Forest Diseases and Insect Pests, Korea Forest Research Institute,
Seoul 130/​012, Republic of Korea. parkik1@foa.go.kr

Plant essential oils from 29 plant species were tested for their insecticidal
activities against the Japanese termite, Reticulitermes speratus Kolbe, using a
fumigation bioassay. Responses varied with plant material, exposure time, and
concentration. Good insecticidal activity against the Japanese termite was
achived with essential oils of Melaleuca dissitiflora, Melaleuca uncinata,
Eucalyptus citriodora, Eucalyptus polybractea, Eucalyptus radiata, Eucalyptus
dives, Eucalyptus globulus, Orixa japonica, Cinnamomum cassia, Allium cepa,
Illicium verum, Evodia officinalis, Schizonepeta tenuifolia, Cacalia
roborowskii, Juniperus chinensis var. horizontalis, Juniperus chinensis var.
kaizuka, clove bud, and garlic applied at 7.6 microL/L of air. Over 90%
mortality after 3 days was achieved with O. japonica essential oil at 3.5
microL/L of air. E. citriodora, C. cassia, A. cepa, I. verum, S. tenuifolia, C.
roborowskii, clove bud, and garlic oils at 3.5 microL/L of air were highly toxic
1 day after treatment. At 2.0 microL/L of air concentration, essential oils of
I. verum, C. roborowskik, S. tenuifolia, A. cepa, clove bud, and garlic gave
100% mortality within 2 days of treatment. Clove bud and garlic oils showed the
most potent antitermitic activity among the plant essential oils. Garlic and
clove bud oils produced 100% mortality at 0.5 microL/L of air, but this
decreased to 42 and 67% after 3 days of treatment at 0.25 microL/L of air,
respectively. Analysis by gas chromatography/​mass spectrometry led to the
identification of three major compounds from garlic oil and two from clove bud
oils. These five compounds from two essential oils were tested individually for
their insecticidal activities against Japanese termites. Responses varied with
compound and dose. Diallyl trisulfide was the most toxic, followed by diallyl
disulfide, eugenol, diallyl sulfide, and beta/​caryophyllene. The essential oils
described herein merit further study as potential fumigants for termite control.

PMID: 15913300 [PubMed /​ indexed for MEDLINE]

83: Environ Mol Mutagen. 2005 Aug;46(2):96/​103.

Genotoxicity of drinking water disinfectants in plant bioassays.

Monarca S, Feretti D, Zani C, Rizzoni M, Casarella S, Gustavino B.

Department of Hygiene and Public Health, University of Perugia, Italy.
monarca@unipg.it

The genotoxicity of two widely used drinking water disinfectants, sodium
hypochlorite (NaClO) and chlorine dioxide (ClO(2)), and a new disinfectant,
peracetic acid (PAA, CH(3)/​CO/​COOH), was evaluated in three short/​term plant
tests: (1) induction of anaphase chromosome aberrations in the root cells of
Allium cepa, (2) micronucleus induction in the root cells of Vicia faba, and (3)
micronucleus induction in Tradescantia pollen cells. The study was carried out
in the laboratory by directly exposing the plants to several concentrations of
the disinfectants in redistilled water at unadjusted (acid) and adjusted
(neutral) pHs. Both 0.1 and 0.2 mg/l NaClO induced chromosome aberrations in the
Allium cepa test at acid pH, but concentrations up to 0.5 mg/l of all the
disinfectants were negative at neutral pH. Concentrations ranging from 0.1 to
0.5 mg/l NaClO, ClO(2,) and PAA induced micronuclei in Vicia faba at acid pH,
while 1/​2 mg/l NaClO and ClO(2) and 0.5/​2 mg/l PAA gave positive responses at
neutral pH. Most of concentrations of ClO(2) produced positive responses in the
Tradescantia micronucleus test. In general, the highest levels of genotoxicity
were observed under acid conditions; at acid pH, significant effects were
induced by low concentrations of ClO(2) and PAA. Since the test concentrations
of disinfectants are typical of those encountered in the biocidal treatment of
tap water and similar concentrations are consumed daily by a large number of
people, the genotoxicity of these compounds may constitute a significant public
health concern. Copyright 2005 Wiley/​Liss, Inc.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15880733 [PubMed /​ indexed for MEDLINE]

84: Theor Appl Genet. 2005 Jun;111(1):120/​7. Epub 2005 Apr 26.

The L locus, one of complementary genes required for anthocyanin production in
onions (Allium cepa), encodes anthocyanidin synthase.

Kim S, Jones R, Yoo KS, Pike LM.

Department of Horticultural Sciences, Vegetable & Fruit Improvement Center,
Texas A&M University, College Station, TX 77845, USA.

Bulb color in onions (Allium cepa) is an important trait, but its complex,
unclear mechanism of inheritance has been a limiting factor in onion cultivar
improvement. The identity of the L locus, which is involved in the color
difference between Brazilian yellow and red onions, is revealed in this study. A
cross was made between a US/​type yellow breeding line and a Brazilian yellow
cultivar. The segregation ratio of nine red to seven yellow onions in the F(2)
population supports the involvement of two complementary genes in anthocyanin
production in the F(1) hybrids. The high/​performance liquid chromatography
(HPLC) and reverse/​transcriptase (RT)/​PCR analysis of the Brazilian yellow
onions indicated that the genes are involved late in the anthocyanin synthesis
pathway. The genomic sequence of the anthocyanidin synthase (ANS) gene in
Brazilian yellow onions showed a point mutation, which results in an amino acid
change of a glycine to an arginine at residue 229. Because this residue is
located adjacent to a highly conserved iron/​binding active site, this mutation
is likely responsible for the inactivation of the ANS gene in Brazilian yellow
onions. Following the isolation of the promoter sequence of the mutant allele, a
PCR/​based marker for allelic selection of the ANS gene was designed. This assay
is based on an insertion (larger than 3 kb) mutation. The marker perfectly
co/​segregated with the color phenotypes in the F(2) populations, thereby
indicating that the L locus encodes ANS.

Publication Types:
Comparative Study
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 15856159 [PubMed /​ indexed for MEDLINE]

85: J Agric Food Chem. 2005 May 4;53(9):3408/​14.

A gamma/​glutamyl peptide isolated from onion (Allium cepa L.) by bioassay/​guided
fractionation inhibits resorption activity of osteoclasts.

Wetli HA, Brenneisen R, Tschudi I, Langos M, Bigler P, Sprang T, Schurch S,
Muhlbauer RC.

Laboratory for Phytopharmacology, Department of Clinical Research, University of
Bern, Murtenstrasse 35, CH/​3010 Bern, Switzerland.

One gram of onion added to the food of rats inhibits significantly (p < 0.05)
bone resorption as assessed by the urinary excretion of tritium released from
bone of 9/​week/​old rats prelabeled with tritiated tetracycline from weeks 1 to
6. To isolate and identify the bone resorption inhibiting compound from onion,
onion powder was extracted and the extract fractionated by column chromatography
and medium/​pressure liquid chromatography. A single active peak was finally
obtained by semipreparative high/​performance liquid chromatography. The
biological activity of the various fractions was tested in vitro on the activity
of osteoclasts to form resorption pits on a mineralized substrate. Medium,
containing the various fractions or the pure compound, was added to osteoclasts
of new/​born rats settled on ivory slices. After 24 h of incubation, the
tartrate/​resistant acid phosphatase positive multinucleated cells, that is,
osteoclasts, were counted. Subsequently, the number of resorption pits was
determined. Activity was calculated as the ratio of resorption pits/osteoclasts
and was compared to a negative control, that is, medium containing 10% fetal
bovine serum only and to calcitonin (10(/​12) M) as a positive control. Finally,
a single peak inhibited osteoclast activity significantly (p < 0.05). The
structure of this compound was elucidated with high/​performance liquid
chromatography/​electrospray ionization/​mass spectrometry, time/​of/​flight
electrospray ionization mass spectrometry, and nuclear magnetic resonance
spectroscopy. The single peak was identified as
gamma/​L/​glutamyl/​trans/​S/​1/​propenyl/​L/​cysteine sulfoxide (GPCS). It has a
molecular mass of 306 Da and inhibits dose/​dependently the resorption activity
of osteoclasts, the minimal effective dose being approximately 2 mM. As no other
peak displayed inhibitory activity, it likely is responsible for the effect of
onion on bone resorption.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15853380 [PubMed /​ indexed for MEDLINE]

86: Rev Environ Health. 2005 Jan/​Mar;20(1):1/​13.

Genotoxic agents detected by plant bioassays.

Ma TH, Cabrera GL, Owens E.

Department of Biological Sciences, Western Illinois University, Macomb, Illinois
61455, USA. tehma@macomb.com

Seven higher plant species (Allium cepa, Arabidopsis thaliana, Glycine max,
Hordeum vulgaris. Tradescantia paludosa, Vicia faba, and Zea mays) were reviewed
for their ability to detect genotoxicity of chemical agents under the U.S.
Environmental Protection Agency (U.S. EPA) Gene/​Tox program in the late 1970s.
Six bioassays/​Allium and Vicia root tip chromosome breaks, Tradescantia
chromosome break, Tradescantia micronucleus, Tradescantia/​stamen/​hair mutation,
and Arabidopsis/​mutation bioassays/​ were established from four plant systems
that are currently in use for detecting the genotoxicity of environmental
agents. Under the Gene/​Tox program, the Crepis capillaris/​chromosome/​aberration
test was added to the existing six bioassays. The current review is limited to
chemical agents that exhibit a positive response to any of these seven plant
bioassays. From 158 articles reviewed, 84 chemicals were compiled in three
categories: carcinogens, clastogens, and mutagens. As none of these plant
bioassays can detect tumor initiation or cancerous growth, the chemicals were
categorized as carcinogens based on their characteristics defined by the U.S.
EPA's Superfund Priority 1 List and/or by the chemical listings of the Sigma and
Aldrich Chemical Companies. Certain mutagens were categorized in the same manner
in addition to the agents detected as mutagens by these plant bioassays.

Publication Types:
Review

PMID: 15835495 [PubMed /​ indexed for MEDLINE]

87: Acta Biol Hung. 2005;56(1/​2):119/​28.

The effects of fungicide benomyl (benlate) on growth and mitosis in onion
(Allium cepa L.) root apical meristem.

Dane F, Dalgic O.

Department of Biology, Faculty of Arts and Sciences, Trakya University, 22030
Edirne, Turkey. feruzandane@yahoo.com

In this study, the effects of benomyl, a systemic fungicide were investigated in
the mitotic cell division in onion (Allium cepa) root tip cells during
germination. For this aim, different concentrations (1, 2, 5, 10 and 20 mM) of
benomyl solutions were used. All the concentrations used caused several
abnormalities in mitotic cell divisions and the mitotic frequency in the onion
root tip cells decreased as the concentration of benomyl solution increased.
Based on our findings, it is reported that benomyl has some negative effects on
mitotic divisions in onion root tip cells.

PMID: 15813220 [PubMed /​ indexed for MEDLINE]

88: J Agric Food Chem. 2005 Apr 6;53(7):2733/​40.

Flavonol glucoside profile of southern Italian red onion (Allium cepa L.).

Bonaccorsi P, Caristi C, Gargiulli C, Leuzzi U.

Dipartimento di Chimica Organica e Biologica, Universita di Messina, Salita
Sperone 31, 98166 S. Agata di Messina, Italy. paolab@isengard.unime.it

High/​performance liquid chromatography/​diode array detector (HPLC/​DAD) coupled
with electron spray mass spectrometry (ESI/​MS/​MS) was used to determine the
flavonol profile in southern Italian red onions (Allium cepa L.). This on/​line
technique allowed the identification of seven flavonols in southern Italian red
onion, quercetin 4'/​glucoside and quercetin 3,4'/​diglucoside being the most
abundant components. Five minor flavonols have been recognized, offering a
characteristic profile of such compounds in red onions under study. Quercetin
3/​glucoside, quercetin 7,4'/​diglucoside, quercetin 3,7,4'/​triglucoside, and
isorhamnetin 4'/​glucoside have been previously reported as minor flavonoid
components in Allium cepa, while isorhamnetin 3,4'/​diglucoside was previously
found in Allium ascalonicum. Traces of isorhamnetin 3/​glucoside and free
quercetin were also detected.

PMID: 15796618 [PubMed /​ indexed for MEDLINE]

89: Food Chem Toxicol. 2005 May;43(5):691/​8.

Fumonisins in foods from Cordoba (Argentina), presence and genotoxicity.

Lerda D, Biaggi Bistoni M, Peralta N, Ychari S, Vazquez M, Bosio G.

Facultad de Ciencias Quimicas, Universidad Catolica de Cordoba, Campus: camino a
Alta Gracia Km 7.5, 5000 Cordoba, Argentina. dlerda@coyspu.com.ar

Fumonisins B(1), B(2)yB(3) (FB(1), FB(2)yFB(3)), are a group of toxins produced
by different mold species, Fusarium moniliforme and Fusarium proliferatum being
the most important ones. Its compounds were tested in chromosome aberrations
(CA), sister chromatid exchange (SCE), and micronucleus (MN) in human
lymphocytes, and, in Allium cepa (onion), the chromosomal aberrations (CA) assay
was used. Moreover, the presence of fumonisins and their producer moulds was
determined in different food substrata in Cordoba city, Argentina. Cytogenetic
studies using FB(1), FB(2) and FB(3) levels gave positive results for the higher
concentrations (5 and 10mug/g) with FB(1). As regards the cytogenetic aspect of
FB(1), we found an increase in the incidence of genetic damage measured by
chromosomal aberrations, sister chromatid exchange, micronuclei and chromosomal
aberrations in Allium cepa. These results indicate that human lymphocytes cells
and plants cells (Allium cepa) have a very sensitive cellular response to the
mycotoxin fumonisin B(1) as observed at the highest concentrations.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15778008 [PubMed /​ indexed for MEDLINE]

90: Water Res. 2005 Mar;39(6):1105/​13.

Genotoxicity of the disinfection by/​products resulting from peracetic acid/​ or
hypochlorite/​disinfected sewage wastewater.

Crebelli R, Conti L, Monarca S, Feretti D, Zerbini I, Zani C, Veschetti E,
Cutilli D, Ottaviani M.

Laboratory of Comparative Toxicology and Ecotoxicology, Istituto Superiore di
Sanita, Rome, Italy.

Wastewater disinfection is routinely carried out to prevent the spread of human
pathogens present in wastewater effluents. To this aim, chemical and physical
treatments are applied to the effluents before their emission in water bodies.
In this study, the influence of two widely used disinfectants, peracetic acid
(PAA) and sodium hypochlorite (NaClO), on the formation of mutagenic by/​products
was investigated. Wastewater samples were collected before and after
disinfection, in winter and in summer, at a pilot plant installed in a municipal
wastewater/​treatment plant. Samples were adsorbed using silica C18 cartridges
and the concentrates were tested for mutagenicity in the Salmonella typhimurium
reversion test with strains TA98 and TA100. Non/​concentrated water samples were
tested with two plant genotoxicity assays (the Allium cepa root anaphase
aberration test and the Tradescantia/micronucleus test). Mutagenicity assays in
bacteria and in Tradescantia showed borderline mutagenicity in some of the
wastewater samples, independent of the disinfection procedure applied. Negative
results were obtained in the A. cepa anaphase aberration test. These results
indicate that, in the conditions applied, wastewater disinfection with PAA and
NaClO does not lead to the formation of significant amounts of genotoxic
by/​products.

PMID: 15766965 [PubMed /​ indexed for MEDLINE]

91: Anal Chem. 2005 Mar 15;77(6):1883/​90.

LC/​MSn methods for saccharide characterization of monoglycosyl flavonoids using
postcolumn manganese complexation.

Davis BD, Brodbelt JS.

Department of Chemistry and Biochemistry, University of Texas at Austin, Austin,
Texas 78712.

A simple tandem mass spectrometry method for differentiating isomeric
monoglycosyl flavonols, flavones, and flavanones using manganese complexation is
reported. Dissociation of the [Mn(II) (L) (L /​ H)]+ and [Mn(II) (L)2 (L /​ H)]+
species provides unique fragment ions that allow the identification of the
saccharide moiety as glucose, galactose, arabinose, or xylose. The glycosylation
site of the flavonoid can also be determined by the fragmentation pathways of
the Mn complexes. The Mn complexation method was adapted for on/​line liquid
chromatography/​mass spectrometry analysis and tested using flavonoid extracts
from Fuji apples (Malus domestica Borkh. cv. Fuji) and red onions (Allium cepa
L.). Using fragmentation data obtained from collisional activated dissociation
of the deprotonated flavonoid glycosides and their Mn complexes, the major
flavonoid species in these extracts were identified.

Publication Types:
Research Support, N.I.H., Extramural
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 15762600 [PubMed /​ indexed for MEDLINE]

92: Commun Agric Appl Biol Sci. 2004;69(4):657/​61.

Antagonistic effects of several bacteria on Fusarium oxysporum, the causal agent
of root and crown rot of onion under field conditions.

Sharifi/​Tehrani A, Saberi/​Riseh R, Heidarian R.

Department of Plant Protection, Faculty of Agriculture, Tehran University, Karaj
31587/​11167, Iran. asharifi@ut.ac.ir

Onion (Allium cepa) is one of the most important vegetable crop which is
commonly used as a food supplement. This plant is found to be vulnerable to
various pathogenic infections during its growth development. Among different
onion diseases, root and crown rot,caused by Fusarium oxysporum f.sp. cepa, s
considered an importantfungal disease. In this study, the inhibitory effect of
Bacillus cereus (isolates 22 and 52), B. subtilis (isolate 126), Pseudomonas
fluorescens (isolates 48 and CHAO), benomyl fungicide and a combination of
isolates CHAO and 22 and isolate 52 and benomyl were investigated on disease
development under the field condition. This experiment was carried out in a
randomize complete blocks with 10 treatments and three repetitions. Grouping of
treatments was done at 5% level using Duncan multiple comparison test. It was
also demonstrated that isolate 126 was the most effective antagonist with regard
to crop yield but other treatments despite showing significant on plant growth
factors were less effective in increasing crop yield.

Publication Types:
Comparative Study

PMID: 15756854 [PubMed /​ indexed for MEDLINE]

93: Cytogenet Genome Res. 2005;109(1/​3):400/​7.

Central cell nuclear/​cytoplasmic incongruity:a mechanism for segregation
distortion in advanced backcross and selfed generations of (Allium cepa L. x
Allium fistulosum L.) x A. cepa interspecific hybrid derivatives.

Mangum PD, Peffley EB.

Department of Biology, Midland College, Midland, TX, USA.

A model is presented as an explanation for an anomaly observed in germination
and establishment and isozyme segregation patterns in Allium cepa x A.
fistulosum F2BC3 populations generated in an introgression/​breeding program. The
F1BC3 parent of these populations was selected for its heterozygous PGI
phenotype, Pgi/​1(2/3); Pgi/​1(2) was inherited from an A. cepa (Ac) seed parent
and Pgi/​1(3) from an A. fistulosum (Af) pollen parent. Germination and
establishment was recorded for the F2BC3 progeny population. Segregation of Ac
and Af Pgi/​1 alleles was investigated in F2BC3 seeds and embryo and endosperm
tissue was isolated and tested for isozyme expression. A pooled goodness/​of/​fit
test of the segregation of Pgi/​1 alleles in the populations to the expected
Mendelian 1:2:1 ratio using the chi/​square statistic gave a chi2 = 185.9, well
beyond the accepted limits at 2 degrees of freedom. The 1:2:1 ratio expected for
simple Mendelian inheritance was rejected, while a pooled chi/​square
goodness/​of/​fit test of the segregation of Pgi/​1 alleles in the populations fit
a 1:1 ratio with a chi2 = 0.203, based on the incongruity model. We present here
the central cell nuclear/​cytoplasmic incongruity hypothesis to explain the
observed anomalies. Copyright 2005 S. Karger AG, Basel.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15753603 [PubMed /​ indexed for MEDLINE]

94: Indian J Med Sci. 2005 Feb;59(2):64/​9.

Effect of fenugreek, onion and garlic on blood glucose and histopathology of
pancreas of alloxan/​induced diabetic rats.

Jelodar GA, Maleki M, Motadayen MH, Sirus S.

Department of Physiology, College of Veterinary Medicine, Shiraz University,
Shiraz 71345, Iran. jelodar@shirazu.ac.ir

BACKGROUND: Many traditional treatments have been recommended in the alternative
system of medicine for treatment of diabetes mellitus; however, the mechanism of
most of the herbals used has not been defined. AIMS: This study was carried out
to clarify the effect of fenugreek, garlic and onion, recommended in Persian
folklore medicine as beneficial in the treatment of diabetes, on blood glucose
and their possible effect on pancreatic tissue. METHODS AND MATERIAL: Diabetes
mellitus was induced in 20 out of 25 adult male albino rats, using
intraperitoneal injection of 185 mg/kg BW alloxan. The diabetic rats were
divided into four groups, three of which were fed a diet containing 12.5% BW
Allium sativum (garlic), Allium cepa (onion) or Trigonella foenum/​graecum
(fenugreek) for 15 days. The fourth group (positive control) received an
ordinary diet. The remaining non/​diabetic rats (negative control group) received
neither alloxan nor the mentioned plants. Following consumption of plants, blood
glucose was measured every day and on the last day the pancreas were removed and
stained with H&E and Gomeri aldehyde fuchsin (GAF). Morphology of the pancreatic
sections and the following morphometric factors were studied: volume density of
B cells, volume density of islets, percent of B cells, number of islets per
square millimeter, average area of islets and average volume density of B cell
in whole pancreas. STATISTICAL ANALYSIS USED: One/​way Analysis of Variance
(ANOVA) test and Duncan's multiple range tests were used to evaluate the data.
RESULTS AND CONCLUSION: The results of this study indicate that only garlic was
able to reduce blood glucose significantly compared with the control group
(P<0.05). In the control positive group all the mentioned morphometric factors
were significantly changed in comparison with the control negative (normal
health) group, but the same did not show significant change between treated and
untreated diabetics.

Publication Types:
Comparative Study

PMID: 15738612 [PubMed /​ indexed for MEDLINE]

95: Genes Genet Syst. 2004 Dec;79(6):345/​50.

Effect of single alien chromosome from shallot (Allium cepa L. Aggregatum group)
on carbohydrate production in leaf blade of bunching onion (A. fistulosum L.).

Hang TT, Shigyo M, Yaguchi S, Yamauchi N, Tashiro Y.

The United Graduated School of Agricultural Sciences, Tottori University,
Tottori 680/​8553, Japan.

We used a complete set of Allium fistulosum /​ shallot (A. cepa Aggregatum group)
monosomic addition lines (FF+1A /​ FF+8A) to identify shallot chromosomes
affecting the production of sugars. In the alien addition lines grown over two
years in an experimental field at Yamaguchi University (34 degrees N, 131
degrees E), shallot chromosomes 2A and 8A altered sugar contents in
leaf/​bunching onion (A. fistulosum). Except for FF+2A, every monosomic addition
accumulated non/​reducing sugars in winter leaf blades. FF+8A caused an increase
in the amounts of non/​reducing sugars in the winter. FF+2A hardly produced
non/​reducing sugar throughout the two/​year study. These results indicated that
genes related to non/​reducing sugar metabolism are located on the 2A and 8A
chromosomes. The results of regression analyses using 2002 data on A. fistulosum
and the monosomic addition set revealed a correlation (r = 0.63 +//​ 0.07; mean
+//​ SE., n = 9) between reducing sugar and monosaccharide (Glc+Fru) contents but
no correlation between non/​reducing sugar and sucrose contents. This result
indicates the existence of other polysaccharides (e.g., scorodose) as
non/​reducing sugars in the leaf blade.

PMID: 15729002 [PubMed /​ indexed for MEDLINE]

96: Protoplasma. 2004 Oct;224(1/​2):41/​7.

Nuclear ploidy is contingent on the microtubular cycle responsible for plant
cytokinesis.

Gimenez/​Abian MI, Gimenez/​Abian JF, Utrilla L, De la Torre C.

Centro de Investigaciones Biologicas, Consejo Superior de Investigaciones
Cientificas, Madrid.

Division of the plant cell relies on the preprophase band of microtubules
(PPB)/​phragmoplast system. Cells of onion (Allium cepa L.) root meristems were
rendered binucleate by preventing the consolidation of cell plate formation in
telophase with 5 mM caffeine. These binucleates developed either a single PPB
around one of their two nuclei or two PPBs, one per nucleus, in the prophase of
the ensuing mitosis. Prophase cells developing one single PPB were shorter in
length (42.3 +//​ 4.1 microm) than those developing 2 PPBs (49.8 +//​ 4.1 microm),
and interphase duration was inversely related to cell length. Cells whose length
was less than or equal to 42 microm, i.e., which had not even reached the mean
size of the small binucleates in prophase, were followed throughout mitosis. In
metaphase, they always assembled two mitotic spindles (one per nucleus).
However, the cells that had assembled a single PPB also developed a single
phragmoplast in telophase, leading to polyploidization. As these meristematic
cells were not wide enough to accommodate the midzones of both mitotic spindles
in any single plane transversal to the cell elongation axis, the spindles tilted
until their midzones formed a continuum where the single common phragmoplast
assembled. Its position was thereby uncoupled from that of the preceding PPB.
Subsequently, the chromosomes from two different half/​spindles were included, by
a common nuclear envelope, in a single tetraploid nucleus. Finally, the
cytokinetic plate segregated the two tetraploid nuclei formed at each side of
the phragmoplast into two independent sister cells.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15726808 [PubMed /​ indexed for MEDLINE]

97: Mutat Res. 2005 Mar 7;581(1/​2):173/​80. Epub 2005 Jan 19.

Salicylic acid triggers genotoxic adaptation to methyl mercuric chloride and
ethyl methane sulfonate, but not to maleic hydrazide in root meristem cells of
Allium cepa L.

Patra J, Sahoo MK, Panda BB.

Genecology and Tissue Culture Laboratory, Department of Botany, Berhampur
University, Berhampur 760007, India.

Salicylic acid (SA), 0.01 mM, a signalling phytohormone, was tested for
induction of adaptive response against genotoxicity of methyl mercuric chloride
(MMCl), 0.013 mM; ethylmethane sulfonate (EMS), 2.5 mM, or maleic hydrazide
(MH), 5 mM, in root meristem cells of Allium cepa. Induction of adaptive
response to EMS by hydrogen peroxide (H2O2), 1 mM, and yet another secondary
signal molecule was tested for comparison. Assessed by the incidence of mitoses
with spindle and/or chromosome aberration and micronucleus, the findings
provided evidence that SA/​conditioning triggered adaptive response against the
genotoxic/​challenges of MMCl and EMS, but failed to do so against MH. H2O2,
which is known to induce adaptive response to MMCl and MH, failed to induce the
same against EMS in the present study. The findings pointed to the possible role
of signal transduction in the SA/​induced adaptive response to genotoxic stress
that perhaps ruled out an involvement of H2O2.

PMID: 15725616 [PubMed /​ indexed for MEDLINE]

98: Phytochemistry. 2005 Mar;66(5):515/​22.

Purification and cloning of a gamma/​glutamyl transpeptidase from onion (Allium
cepa).

Shaw ML, Pither/​Joyce MD, McCallum JA.

New Zealand Institute for Crop & Food Research Limited, Germplasm Enhancement,
Private Bag 4704, Christchurch 8000, New Zealand.

Gamma/​glutamyl transpeptidase (E.C. 2.3.2.2; GGT) catalyses hydrolysis of
gamma/​glutamyl linkages in gamma/​glutamyl peptides and transfer of the
gamma/​glutamyl group to amino acids and peptides. Although plant gamma/​glutamyl
peptide metabolism is important in biosynthesis and metabolism of secondary
products and xenobiotics, plant GGTs are poorly characterised. We purified a
membrane/​associated GGT from sprouting onion bulbs that catalyses
transpeptidation of methionine by the synthetic substrate
gamma/​glutamyl/​p/​nitroanilide (GGPNA) and obtained N/​terminal peptide sequence.
We also cloned the full/​length coding region of an onion GGT by homology with
the Arabidopsis enzyme and confirmed that this shared the same N/​terminal
sequence. Enzyme kinetic studies show that the enzyme has high affinity for
glutathione and glutathione conjugates, and that affinity for S/​substituted
glutathione analogs decreases as the substituted chain length increases. The
major onion gamma/​glutamyl peptide, gamma/​glutamyl trans/​S/​1/​propenyl cysteine
sulfoxide (GGPrCSO) exhibited uncompetitive inhibition of transpeptidation by
GGPNA. This suggests that GGPrCSO is a poor glutamyl donor and therefore
unlikely to be an in vivo substrate for peptidase activity by this enzyme.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15721943 [PubMed /​ indexed for MEDLINE]

99: Environ Res. 2005 May;98(1):1/​7.

Diesel emissions significantly influence composition and mutagenicity of ambient
particles: a case study in Sao Paulo, Brazil.

Carvalho/​Oliveira R, Pozo RM, Lobo DJ, Lichtenfels AJ, Martins/​Junior HA,
Bustilho JO, Saiki M, Sato IM, Saldiva PH.

Laboratory of Experimental Air Pollution, Department of Pathology, School of
Medicine, Faculty of Medicine, University of Sao Paulo, Av. Dr. Arnaldo 455, CEP
01246/​903 Sao Paulo, SP, Brazil.

In 2003, a bus strike paralyzed the fleet of buses in Sao Paulo, Brazil during 3
days, from 6 to 8 of April, the complete interruption of services being achieved
on the 7th. We evaluated the effect of the absence of this source of pollution
on the composition, mutagenicity, and toxicity of the fine particulate material
collected during this period. Particles were sampled in glass fiber filters on
days 7 and 15 of April of 2003 (strike and nonstrike days, respectively), using
a high/​volume sampler. Trace element determinations (As, Br, Co, Cl, Fe, La, Mn,
Sb, Sc, and Th) of particulate material samples were carried out by neutron
activation analysis. Sulfur determination was done by X/​ray fluorescence
analysis. The ratio between nonstrike/strike concentrations of hydrocarbons
associated with automotive emissions (benzene, toluene, ethyl/​benzene, and
xylenes; BTEX) was determined by gas chromatography/mass spectrometry.
Mutagenesis of testing solutions was determined by means of the Tradescantia
micronucleus assay in early tetrads of Tradescantia pallida. The inhibition of
mitosis of the cells of the primary meristema of the root tips of Allium cepa
was used as an index of the toxicity. Fine particle trace element contents were
lower during the strike. The concentrations of sulfur and BTEX were 50% and
39.3% lower, respectively, on the strike day. A significant (P=0.038) reduction
of micronuclei induced by fine particles sampled during the strike was observed.
No effect of the strike on toxicity was detected. These results indicate that a
program aiming to reduce emissions of the bus fleet in our town may impact
positively the air quality by reducing the mutagenic potential of ambient
particles.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15721877 [PubMed /​ indexed for MEDLINE]

100: New Phytol. 2005 Feb;165(2):513/​24.

Purification and characterization of a fructosyltransferase from onion bulbs and
its key role in the synthesis of fructo/​oligosaccharides in vivo.

Fujishima M, Sakai H, Ueno K, Takahashi N, Onodera S, Benkeblia N, Shiomi N.

Department of Food and Nutrition Sciences, Graduate School of Dairy Science
Research, Rakuno Gakuen University, 582 Bunkyodai, Midorimachi, Ebetsu, Hokkaido
069/​8501, Japan.

A fructosyltransferase that transfers the terminal (2 /​/​> 1)/​beta/​linked
D/​fructosyl group of fructo/​oligosaccharides (1(F)(1/​beta/​D/​fructofuranosyl)(n)
sucrose, n >/= 1) to HO/​6 of the glucosyl residue and HO/​1 of the fructosyl
residue of similar saccharides (1(F)(1/​beta/​D/​fructofuranosyl)(m) sucrose, m >/=
0) has been purified from an extract of the bulbs of onion (Allium cepa).
Successive column chromatography using DEAE/​Sepharose CL/​6B, Toyopearl HW65,
Toyopearl HW55, DEAE/​Sepharose CL/​6B (2nd time), Sephadex G/​100, Concanavalin A
Sepharose, and Toyopearl HW/​65 (2nd time) were applied for protein purification.
The general properties of the enzyme, were as follows: molecular masses of 66
kDa (gel filtration chromatography), and of 52 kDa and 25 kDa (SDS/​PAGE);
optimum pH of c. 5.68, stable at 20/​40 degrees C for 15 min; stable in a range
of pH 5.30/​6.31 at 30 degrees C for 30 min, inhibited by Hg(2+), Ag(+),
p/​chloromercuribenzoic acid (p/​CMB) and sodium dodecyl sulfate (SDS), activated
by sodium deoxycholate, Triton X/​100 and Tween/​80. The amino acid sequence of
the N/​terminus moiety of the 52/​kDa polypeptide was
ADNEFPWTNDMLAWQRCGFHFRTVRNYMNDPSGPMYYKGWYHLFYQHNKDFAYXG and the amino acid
sequence from the N/​terminus of the 25/​kDa polypeptide was
ADVGYXCSTSGGAATRGTLGPFGLL VLANQDLTENTATYFYVSKGTDGALRTHFCQDET. The enzyme
tentatively classified as fructan: fructan 6(G)/​fructosyltransferase (6G/​FFT).
The enzyme is proposed to play an important role in the synthesis of inulin and
inulinneo/​series fructo/​oligosaccharides in onion bulbs.

PMID: 15720662 [PubMed /​ indexed for MEDLINE]

101: J Agric Food Chem. 2005 Feb 23;53(4):935/​40.

Antispasmodic saponins from bulbs of red onion, Allium cepa L. var. Tropea.

Corea G, Fattorusso E, Lanzotti V, Capasso R, Izzo AA.

Dipartimento di Chimica delle Sostanze Naturali, Universita di Napoli Federico
II, Via D. Montesano 49, I/​80131 Napoli, Italy.

A phytochemical analysis of the polar extract from the red bulbs of Allium cepa
L. var. Tropea, typical of Calabria, a southern region of Italy, was performed
extensively for the first time, leading to the isolation of four new furostanol
saponins, named tropeoside A1/A2 (1a/1b) and tropeoside B1/B2 (3a/3b), along
with the respective 22/​O/​methyl derivatives (2a/2b and 4a/4b), almost certainly
extraction artifacts. High concentrations of ascalonicoside A1/A2 (5a/5b) and
ascalonicoside B (6), previously isolated from Allium ascalonicum Hort., were
also found. This is the first report of furostanol saponins in this A. cepa
variety. The chemical structures of the new compounds were established through a
combination of extensive nuclear magnetic resonance, mass spectrometry and
chemical analyses. High concentrations of quercetin, quercetin 4(I)/​glucoside,
taxifolin, taxifolin 7/​glucoside, and phenylalanine were also isolated. The new
saponins were found to possess antispasmodic activity in the guinea pig isolated
ileum; such an effect might contribute to explaining the traditional use of
onion in the treatment of disturbances of the gastrointestinal tract.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15713001 [PubMed /​ indexed for MEDLINE]

102: Int J Food Microbiol. 2005 Feb 15;98(3):319/​23.

Effectiveness of household natural sanitizers in the elimination of Salmonella
typhimurium on rocket (Eruca sativa Miller) and spring onion (Allium cepa L.).

Yucel Sengun I, Karapinar M.

Ege University, Engineering Faculty, Food Engineering Department, 35100,
Bornova, Izmir, Turkey.

Experiments were done with fresh lemon juice, vinegar and their mixture (1:1) to
evaluate their efficacy in reducing the numbers of Salmonella typhimurium on
fresh salad vegetables. Fresh whole rocket leaves and shredded spring onion
samples were inoculated with S. typhimurium suspensions to provide initial
populations of approximately 6 and 3 log cfu/g. After inoculation, vegetables
were treated with the test solutions for 0, 15, 30 and 60 min, and pathogens
were enumerated by using direct plating on Bismuth Sulphite Agar (BSA). Prior to
this work, it was shown that BSA was not toxic for acid injured Salmonella cells
by statistical analysis applied to enriched and non/​enriched samples (P>0.05).
Treatment of rocket leaves with fresh lemon juice and vinegar caused a
significant reduction ranging between 1.23 and 4.17 log cfu/g and between 1.32
and 3.12 log cfu/g, respectively, while the maximum reduction reached by using
lemon juice/​vinegar mixture (1:1) for 15 min, which reduced the number of
pathogens to an undetectable level. In the spring onion samples, lemon juice,
vinegar and their mixture caused 0.87/​2.93, 0.66/​2.92 and 0.86/​3.24 log cfu/g
reductions, respectively.

PMID: 15698693 [PubMed /​ indexed for MEDLINE]

103: J Agric Food Chem. 2005 Feb 9;53(3):538/​48.

Structure/​Activity Relationships (SAR) studies of benzoxazinones, their
degradation products and analogues. phytotoxicity on standard target species
(STS).

Macias FA, Marin D, Oliveros/​Bastidas A, Castellano D, Simonet AM, Molinillo JM.

Grupo de Alelopatia, Departamento de Quimica Organica, Facultad de Ciencias,
Universidad de Cadiz, C/Republica Saharaui, s/n, 11510 Puerto Real, Cadiz,
Spain. famacias@uca.es

Benzoxazinones 2,4/​dihydroxy/​7/​methoxy/​(2H)/​1,4/​benzoxazin/​3(4H)/​one (DIMBOA)
and 2,4/​dihydroxy/​(2H)/​1,4/​benzoxazin/​3(4H)/​one (DIBOA) have been considered key
compounds for understanding allelopathic phenomena in Gramineae crop plants such
as corn (Zea mays L.), wheat (Triticum aestivum L.), and rye (Secale cereale
L.). The degradation processes in the environment observed for these compounds,
in which soil microbes are directly involved, could affect potential
allelopathic activity of these plants. We present in this work a complete
structure/​activity relationships study based on the phytotoxic effects observed
for DIMBOA, DIBOA, and their main degradation products, in addition to several
synthetic analogues of them. Their effects were evaluated on standard target
species (STS), which include Triticum aestivum L. (wheat) and Allium cepa L.
(onion) as monocots and Lepidium sativum L. (cress), Lactuca sativa L.
(lettuce), and Lycopersicon esculentum Will. (tomato) as dicots. This permitted
us to elucidate their ecological role and to propose new herbicide models based
on their structures. The best phytotoxicity results were shown by the
degradation chemical 2/​aminophenoxazin/​3/​one (APO) and several 2/​deoxy
derivatives of natural benzoxazinones, including
4/​acetoxy/​(2H)/​1,4/​benzoxazin/​3(4H)/​one (ABOA),
4/​hydroxy/​(2H)/​1,4/​benzoxazin/​3(4H)/​one (D/​DIBOA), and
4/​hydroxy/​7/​methoxy/​(2H)/​1,4/​benzoxazin/​3(4H)/​one (D/​DIMBOA). They showed high
inhibitory activity over almost all species growth. The fact that APO is a
degradation product from DIBOA with high phytotoxicity and stability makes it
possible to assign an important ecological role regarding plant defense
mechanisms. 2/​Deoxy derivatives of natural benzoxazinones display a wide range
of activities that allow proposing them as new leads for natural herbicide
models with a 1,4/​benzoxazine skeleton.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15686399 [PubMed /​ indexed for MEDLINE]

104: Plant Biol (Stuttg). 2005 Jan;7(1):41/​8.

Specificity patterns indicate that auxin exporters and receptors are the same
proteins.

Hossel D, Schmeiser C, Hertel R.

Institut Biologie III, Albert/​Ludwig/​Universitat, Schanzlestrasse 1, 79104
Freiburg, Germany.

A study of transport and action of synthetic auxin analogues can help to
identify transporters and receptors of this plant hormone. Both
aspects/​/​transportability and action on growth/​/​were tested with
2/​naphthoxyacetic acid (2/​NOA) and compared across several plant species. 2/​NOA
stimulates elongation effectively at low concentrations in petioles of the
gymnosperm Ginkgo biloba L., in hypocotyls or internodes of the dicot legumes,
mung bean (Vigna mungo L.) and pea (Pisum sativum L.), in cotyledons of onion
(Allium cepa L.) and in leaf bases of chive (Allium schoenoprasum L.), the
latter two of the monocot order Asparagales. In contrast, elongation of
coleoptile segments of maize (Zea mays L.) is poorly responsive to 2/​NOA.
Significant auxin/​like transport of 2/​NOA was observed in segments of mung bean
hypocotyls, pea internodes, and chive leaf bases, but not in segments of the
grass coleoptiles. Thus, for the two assays, elongation and polar
transportability, the same difference in ligand specificity was observed between
the grass and all other species assayed. This finding supports the hypothesis
that a common protein mediates auxin efflux as well as auxin action on
elongation.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15666213 [PubMed /​ indexed for MEDLINE]

105: Fitoterapia. 2005 Jan;76(1):1/​25.

Traditional phytotherapy in Central Italy (Marche, Abruzzo, and Latium).

Guarrera PM.

Museo Nazionale Arti e Tradizioni Popolari, Piazza Marconi 8/​10, Roma, 00144,
Italy. popolari@arti.beniculturali.it

In this study, the more significant results of extensive ethnopharmacobotanical
research carried out by the author in the years 1977/​2000 in 175 localities of
three regions of Central Italy (Marche, Abruzzo, and Latium) have been reported
and compared. The usages of 80 species belonging to 36 families are described,
of which 71 were used in human therapy and 29 in veterinary medicine. Uses are
suited with the number of localities in which they have been mentioned. Among
the wild plant mainly still used, Malva sylvestris, Urtica dioica, and Sambucus
nigra are particularly highly considered, while major uses of plants concern
these plants in addition to Allium sativum, Rubus ulmifolius, Parietaria
diffusa, Cynodon dactylon, and Ficus carica. Unusual phytotherapic uses concern
Brassica oleracea, Taraxacum officinale (warts), Ruscus aculeatus, S. nigra
(chilblains), Allium cepa (chilblains; to remove thorns and splinters), Juglans
regia, R. ulmifolius (burns), and Euphorbia paralias (bites of weevers). Among
new uses with only one quotation, we remember Cirsium arvense (intestinal
disturbances), Centaurea bracteata (cough), Lupinus albus (calluses), Melittis
melissophyllum (eye inflammations, antispasmodic), and Artemisia absinthium
(tendon inflammations), while among plants employed in various regions with
interesting less/​known properties, there are C. arvense (emergency haemostatic),
P. diffusa (insect bites), and Scrophularia canina (antiseptic and cicatrizing
agent for wounds in bovines and sheep).

Publication Types:
Review

PMID: 15664457 [PubMed /​ indexed for MEDLINE]

106: Theor Appl Genet. 2005 Feb;110(4):628/​33. Epub 2005 Jan 20.

Erratum in:
Theor Appl Genet. 2005 Apr;110(6):1167.

Development of a co/​dominant, PCR/​based marker for allelic selection of the pink
trait in onions (Allium cepa), based on the insertion mutation in the promoter
of the anthocyanidin synthase gene.

Kim S, Yoo KS, Pike LM.

Vegetable and Fruit Improvement Center, Department of Horticultural Sciences,
Texas A&M University, College Station, TX 77843, USA.

Bulb color in onions (Allium cepa) is an important trait and is inherited in a
complex manner. However, the mechanism of color inheritance is poorly understood
at the molecular level. A previous study showed that pink bulb color in onions
is inherited as a single recessive trait. This trait is attributable to a
significantly reduced transcription of the anthocyanidin synthase (ANS) gene. In
this study, we developed a PCR/​based marker for an allelic selection of the ANS
gene to avoid the laborious progeny tests traditionally employed. To identify
polymorphisms between pink and red alleles of the ANS gene, promoter sequences
of both alleles were isolated. There was 97% nucleotide sequence identity
between the promoter sequences of the two alleles. A 390/​bp insertion was
identified 632 bp upstream from the putative transcription start site in the
pink allele. A pair of primers was designed on the flanking sequences of the
inserted region and utilized as a PCR/​based marker for allelic selection of the
ANS gene. The reliability of the marker was tested using parents, F1 hybrids,
and F3 lines whose genotypes had been identified by progeny tests. The marker
was also used to evaluate the distribution of the pink allele in white and
yellow breeding lines. The results indicated that a majority of the breeding
lines tested were homozygous recessive.

Publication Types:
Duplicate Publication
Evaluation Studies
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 15660238 [PubMed /​ indexed for MEDLINE]

107: Plant Cell. 2005 Feb;17(2):475/​85. Epub 2005 Jan 19.

The Dof transcription factor OBP3 modulates phytochrome and cryptochrome
signaling in Arabidopsis.

Ward JM, Cufr CA, Denzel MA, Neff MM.

Department of Biology, Washington University, St. Louis, Missouri 63130, USA.

Plants perceive subtle changes in light quality and quantity through a set of
photoreceptors, including phytochromes and cryptochromes. Upon perception, these
photoreceptors initiate signal transduction pathways leading to photomorphogenic
changes in development. Using activation/​tagging mutagenesis to identify novel
light/​signaling components, we have isolated a gain/​of/​function mutant, sob1/​D
(suppressor of phytochrome B/​4 [phyB/​4] dominant), which suppresses the
long/​hypocotyl phenotype of the phyB missense allele, phyB/​4. The sob1/​D mutant
phenotype is caused by the overexpression of a Dof (DNA binding with one finger)
transcription factor, OBF4 Binding Protein 3 (OBP3). A translational fusion
between OBP3 and green fluorescent protein is nuclear localized in onion (Allium
cepa) cells. Tissue/​specific accumulation of an OBP3:OBP3/​beta/​glucuronidase
translational fusion is regulated by light in Arabidopsis thaliana. Hypocotyls
of transgenic lines with reduced OBP3 expression are less responsive to red
light. This aberrant phenotype in red light requires functional phyB, suggesting
that OBP3 is a positive regulator of phyB/​mediated inhibition of hypocotyl
elongation. Furthermore, these partial/​loss/​of/​function lines have larger
cotyledons. This light/​dependent cotyledon phenotype is most dramatic in blue
light and requires functional cryptochrome 1 (cry1), indicating that OBP3 is a
negative regulator of cry1/​mediated cotyledon expansion. These results suggest a
model where OBP3 is a component in both phyB and cry1 signaling pathways, acting
as a positive and negative regulator, respectively. An alternate, though not
mutually exclusive, model places OBP3 as a general inhibitor of tissue expansion
with phyB and cry1, differentially modulating OBP3's role in this response.

Publication Types:
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 15659636 [PubMed /​ indexed for MEDLINE]

108: Plant Cell. 2005 Feb;17(2):389/​403. Epub 2005 Jan 19.

Functional isolation of novel nuclear proteins showing a variety of subnuclear
localizations.

Moriguchi K, Suzuki T, Ito Y, Yamazaki Y, Niwa Y, Kurata N.

Plant Genetics Laboratory, National Institute of Genetics, Mishima, Shizuoka
411/​8540, Japan.

Nuclear proteins play key roles in the fundamental regulation of genome
instability, the phases of organ development, and physiological responsiveness
through gene expression. Although nuclear proteins have been shown to account
for approximately one/​fourth of total proteins in yeast, no efficient method to
identify novel nuclear proteins has been applied to plants. In this study, a
trial to isolate nuclear proteins in rice was attempted, and several novel
nuclear proteins showing a variety of subnuclear localizations were identified.
The nuclear transportation trap (NTT) system, which is a modified two/​hybrid
system, isolated many nuclear proteins from rice (Oryza sativa) NTT cDNA
libraries. Nuclear localization of the isolated proteins was confirmed by
transient introduction of green fluorescent protein fusion constructs for a
subset of protein genes into onion (Allium cepa) cells. The majority of these
proteins, including novel proteins and proteins initially categorized as
cytoplasmic proteins, were revealed to be localized in the nucleus. Detailed
characterization of unknown proteins revealed various subnuclear localizations,
indicating their possible association with chromatin and the nuclear matrix with
a foci or speckle/​like distribution. Some also showed dual distribution in the
nucleus and cytoplasm. In the novel protein fraction, a protein was further
identified for its chromatin/​associated localization in a specific organ of rice
by immunostaining. Thus, a variety of novel nuclear architectural proteins with
chromatin or matrix associating abilities, which are important in nuclear
organization by influencing certain organ developments or cell responsiveness,
can be isolated using the NTT method. Because nuclear proteins other than
transcription regulators have rarely been characterized in plants, such as
matrix proteins and development/​specific chromatin proteins, their
identification and subsequent characterization could provide important
information for genome/​wide regulatory mechanisms controlled by nuclear
organization.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15659629 [PubMed /​ indexed for MEDLINE]

109: Plant Cell. 2005 Feb;17(2):525/​36. Epub 2005 Jan 19.

Dissection of Arabidopsis ADP/​RIBOSYLATION FACTOR 1 function in epidermal cell
polarity.

Xu J, Scheres B.

Department of Molecular Cell Biology, Utrecht University, 3584 CH Utrecht, The
Netherlands.

Vesicle trafficking is essential for the generation of asymmetries, which are
central to multicellular development. Core components of the vesicle transport
machinery, such as ADP/​ribosylation factor (ARF) GTPases, have been studied
primarily at the single/​cell level. Here, we analyze developmental functions of
the ARF1 subclass of the Arabidopsis thaliana multigene ARF family. Six
virtually identical ARF1 genes are ubiquitously expressed, and single
loss/​of/​function mutants in these genes reveal no obvious developmental
phenotypes. Fluorescence colocalization studies reveal that ARF1 is localized to
the Golgi apparatus and endocytic organelles in both onion (Allium cepa) and
Arabidopsis cells. Apical/​basal polarity of epidermal cells, reflected by the
position of root hair outgrowth, is affected when ARF1 mutants are expressed at
early stages of cell differentiation but after they exit mitosis. Genetic
interactions during root hair tip growth and localization suggest that the ROP2
protein is a target of ARF1 action, but its localization is slowly affected upon
ARF1 manipulation when compared with that of Golgi and endocytic markers.
Localization of a second potential target of ARF1 action, PIN2, is also affected
with slow kinetics. Although extreme redundancy precludes conventional genetic
dissection of ARF1 functions, our approach separates different ARF1 downstream
networks involved in local and specific aspects of cell polarity.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15659621 [PubMed /​ indexed for MEDLINE]

110: Genetics. 2005 Mar;169(3):1673/​85. Epub 2005 Jan 16.

The integration of recombination and physical maps in a large/​genome monocot
using haploid genome analysis in a trihybrid allium population.

Khrustaleva LI, de Melo PE, van Heusden AW, Kik C.

Plant Research International, Wageningen University and Research Center, The
Netherlands.

Integrated mapping in large/​genome monocots has been carried out on a limited
number of species. Furthermore, integrated maps are difficult to construct for
these species due to, among other reasons, the specific plant populations
needed. To fill these gaps, Alliums were chosen as target species and a new
strategy for constructing suitable populations was developed. This strategy
involves the use of trihybrid genotypes in which only one homeolog of a
chromosome pair is recombinant due to interspecific recombination. We used
genotypes from a trihybrid Allium cepa x (A. roylei x A. fistulosum) population.
Recombinant chromosomes 5 and 8 from the interspecific parent were analyzed
using genomic in situ hybridization visualization of recombination points and
the physical positions of recombination were integrated into AFLP linkage maps
of both chromosomes. The integrated maps showed that in Alliums recombination
predominantly occurs in the proximal half of chromosome arms and that 57.9% of
PstI/MseI markers are located in close proximity to the centromeric region,
suggesting the presence of genes in this region. These findings are different
from data obtained on cereals, where recombination rate and gene density tends
to be higher in distal regions.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15654085 [PubMed /​ indexed for MEDLINE]

111: Theor Appl Genet. 2005 Feb;110(3):573/​8. Epub 2005 Jan 14.

Erratum in:
Theor Appl Genet. 2005 Apr;110(6):1167.

Development of a codominant PCR/​based marker for allelic selection of the pink
trait in onions (Allium cepa), based on the insertion mutation in the promoter
of the anthocyanidin synthase gene.

Kim S, Yoo KS, Pike LM.

Vegetable and Fruit Improvement Center, Department of Horticultural Sciences,
Texas A&M University, College Station, TX, 77843, USA.

Bulb color in onions (Allium cepa) is an important trait and is inherited in a
complex manner. However, the mechanism of color inheritance is poorly understood
at the molecular level. A previous study showed that pink bulb color in onions
is inherited as a single recessive trait. This trait is attributable to a
significantly reduced transcription of the anthocyanidin synthase (ANS) gene. In
this study, we developed a PCR/​based marker for an allelic selection of the ANS
gene to avoid the laborious progeny tests traditionally employed. To identify
polymorphisms between pink and red alleles of the ANS gene, promoter sequences
of both alleles were isolated. There was 97% nucleotide sequence identity
between the promoter sequences of the two alleles. A 390/​bp insertion was
identified 632 bp upstream from the putative transcription start site in the
pink allele. A pair of primers was designed on the flanking sequences of the
inserted region and utilized as a PCR/​based marker for allelic selection of the
ANS gene. The reliability of the marker was tested using parents, F1 hybrids,
and F3 lines whose genotypes had been identified by progeny tests. The marker
was also used to evaluate the distribution of the pink allele in white and
yellow breeding lines. The results indicated that a majority of the breeding
lines tested were homozygous recessive.

Publication Types:
Duplicate Publication
Evaluation Studies
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 15650815 [PubMed /​ indexed for MEDLINE]

112: Theor Appl Genet. 2005 Feb;110(3):588/​95. Epub 2005 Jan 13.

Development of a PCR/​based marker utilizing a deletion mutation in the
dihydroflavonol 4/​reductase (DFR) gene responsible for the lack of anthocyanin
production in yellow onions (Allium cepa).

Kim S, Yoo KS, Pike LM.

Vegetable and Fruit Improvement Center, Department of Horticultural Sciences,
Texas A&M University, TX, 77845, USA.

Bulb color in onions (Allium cepa) is an important trait, but the mechanism of
color inheritance is poorly understood at the molecular level. A previous study
showed that inactivation of the dihydroflavonol 4/​reductase (DFR) gene at the
transcriptional level resulted in a lack of anthocyanin production in yellow
onions. The objectives of the present study were the identification of the
critical mutations in the DFR gene (DFR/​A) and the development of a PCR/​based
marker for allelic selection. We report the isolation of two additional DFR
homologs (DFR/​B and DFR/​C). No unique sequences were identified in either DFR
homolog, even in the untranslated region (UTR). Both genes shared more than 95%
nucleotide sequence identity with the DFR/​A gene. To obtain a unique sequence
from each gene, we isolated the promoter regions. Sequences of the DFR/​A and
DFR/​B promoters differed completely from one another, except for an
approximately 100/​bp sequence adjacent to the 5'UTR. It was possible to
specifically amplify only the DFR/​A gene using primers designed to anneal to the
unique promoter region. The sequences of yellow and red DFR/​A alleles were the
same except for a single base/​pair change in the promoter and an approximately
800/​bp deletion within the 3' region of the yellow DFR/​A allele. This deletion
was used to develop a co/​dominant PCR/​based marker that segregated perfectly
with color phenotypes in the F2 population. These results indicate that a
deletion mutation in the yellow DFR/​A gene results in the lack of anthocyanin
production in yellow onions.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 15647922 [PubMed /​ indexed for MEDLINE]

113: Aquat Toxicol. 2005 Jan 26;71(2):183/​92. Epub 2004 Dec 29.

Ecotoxicological evaluation of the additive butylated hydroxyanisole using a
battery with six model systems and eighteen endpoints.

Jos A, Repetto G, Rios JC, del Peso A, Salguero M, Hazen MJ, Molero ML,
Fernandez/​Freire P, Perez/​Martin JM, Labrador V, Camean A.

Area of Toxicology, Faculty of Pharmacy, University of Seville, Spain.

The occurrence and fate of additives in the aquatic environment is an emerging
issue in environmental chemistry. This paper describes the ecotoxicological
effects of the commonly used additive butylated hydroxyanisole (BHA) using a
test battery, comprising of several different organisms and in vitro test
systems, representing a proportion of the different trophic levels. The most
sensitive system to BHA was the inhibition of bioluminescence in Vibrio fischeri
bacteria, which resulted in an acute low observed adverse effect concentration
(LOAEC) of 0.28 microM. The next most sensitive system was the immobilization of
the cladoceran Daphnia magna followed by: the inhibition of the growth of the
unicellular alga Chlorella vulgaris; the endpoints evaluated in Vero (mammalian)
cells (total protein content, LDH activity, neutral red uptake and MTT
metabolization), mitotic index and root growth inhibition in the terrestrial
plant Allium cepa, and finally, the endpoints used on the RTG/​2 salmonid fish
cell line (neutral red uptake, total protein content, MTS metabolization,
lactate dehydrogenase leakage and activity, and glucose/​6/​phosphate
dehydrogenase activity). Morphological alterations in RTG/​2 cells were also
assessed and these included loss of cells, induction of cellular pleomorphism,
hydropic degeneration and induction of apoptosis at high concentrations. The
results from this study also indicated that micronuclei were not induced in
A.cepa exposed to BHA. The differences in sensitivity for the diverse systems
that were used (EC50 ranged from 1.2 to >500 microM) suggest the importance for
a test battery approach in the evaluation of the ecological consequences of
chemicals. According to the results, the levels of BHA reported in industrial
wastewater would elicit adverse effects in the environment. This, coupled with
its potential to bioaccumulate, makes BHA a pollutant of concern not only for
acute exposures, but also for the long/​term.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 15642642 [PubMed /​ indexed for MEDLINE]

114: Genes Genet Syst. 2004 Oct;79(5):263/​9.

Production and characterization of alien chromosome additions in shallot (Allium
cepa L. Aggregatum group) carrying extra chromosome(s) of Japanese bunching
onion (A. fistulosum L.).

Hang TT, Shigyo M, Yamauchi N, Tashiro Y.

The United Graduated School of Agricultural Sciences, Tottori University,
Tottori 680/​8553, Japan.

First and second backcrosses of amphidiploid hybrids (2n = 4x = 32, genomes
AAFF) between shallot (Allium cepa Aggregatum group) and A. fistulosum were
conducted to produce A. cepa /​ A. fistulosum alien addition lines. When shallot
(A. cepa Aggregatum group) was used as a pollinator, the amphidiploids and
allotriploids set germinable BC(1) and BC(2) seeds, respectively. The 237 BC(1)
plants mainly consisted of 170 allotriploids (2n = 3x = 24, AAF) and 42
hypo/​allotriploids possessing 23 chromosomes, i.e., single/​alien deletions (2n =
3x/​1 = 23, AAF/​nF). The single/​alien deletions in the BC(1) progeny showed
dwarfing characteristics and were discriminated from the allotriploids (2n = 24)
and hyper/​allotriploids (2n = 25) by means of flow cytometric analysis. The
chromosome numbers of 46 BC(2) seedlings varied from 16 to 24. Eight monosomic
additions (2n = 2x+1 = 17, AA+nF) and 20 single/​alien deletions were found in
these BC(2) seedlings. Consequently, six kinds of A. cepa /​ A. fistulosum alien
chromosome additions possessing different chromosome numbers (2n = 17, 18, 20,
21, 22, 23) were recognized in the BC(1) and BC(2) populations. A total of 79
aneuploids, including 62 single/​alien deletions, were analyzed by a chromosome
6F/​specific isozyme marker (Got/​2) in order to recognize its existence in their
chromosome complements. This analysis revealed that two out of 62 single/​alien
deletions did not possess 6F. One (AAF/​6F) out of the possible eight
single/​alien deletions could be identified at first. The present study is a
first step toward the development of a useful tool, such as a complete set of
eight different single/​alien deletions, for the rapid chromosomal assignment of
genes and genetic markers in A. fistulosum.

PMID: 15599056 [PubMed /​ indexed for MEDLINE]

115: Plant Physiol. 2004 Dec;136(4):4010/​22.

Arabidopsis FHY3/FAR1 gene family and distinct roles of its members in light
control of Arabidopsis development.

Lin R, Wang H.

Boyce Thompson Institute for Plant Research, Cornell University, Ithaca, New
York 14853, USA.

FHY3 (far/​red elongated hypocotyls 3) and FAR1 (far/​red/​impaired response) are
two homologous proteins essential for phytochrome A controlled far/​red responses
in Arabidopsis (Arabidopsis thaliana). There are 12 additional FHY3/FAR1/​related
genes in the Arabidopsis genome. The predicted sizes of this family of proteins
range from 531 amino acids to 851 amino acids, and they share 12.0% to 82.4%
amino acid identities over their entire lengths. In addition, most FRS proteins
contain one to three coiled/​coil domains and one or two putative nuclear
localization signals. Semiquantitative reverse transcription/​polymerase chain
reaction analyses revealed that all FRS genes except FRS10 are expressed in all
tissues examined, including rosette leaves, cauline leaves, inflorescence stems,
flowers, and siliques. Analyses of gene specific promoterGUS fusion reporter
gene expression revealed that all FRS genes except FRS1 are expressed in
hypocotyls, and their expression in hypocotyl is induced by far/​red light
treatment. Transient expression of green fluorescent protein tagged FRS fusion
proteins in onion (Allium cepa) epidermal cells revealed that all FRS proteins
are targeted into the nucleus. T/​DNA knockout frs6 and frs8 mutants flowered
early under both long/​day and short/​day conditions (with much more drastic
effects under short/​day conditions), suggesting that FRS6 and FRS8 regulate
flowering time. In addition, FRS9 RNAi transgenic plants showed a specific
hypersensitivity to red light inhibition of hypocotyl elongation and
light/​regulated gene expression, indicating that FRS9 is a specific negative
regulator of phyB signaling mediating seedling deetiolation. In summary, our
results support the notion that FRS family members play distinct roles in light
control of Arabidopsis development, most likely by regulating nuclear gene
expression.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15591448 [PubMed /​ indexed for MEDLINE]

116: J Exp Bot. 2005 Feb;56(412):685/​94. Epub 2004 Dec 6.

Changes in intracellular and apoplastic peroxidase activity, ascorbate redox
status, and root elongation induced by enhanced ascorbate content in Allium cepa
L.

Cordoba/​Pedregosa Mdel C, Villalba JM, Cordoba F, Gonzalez/​Reyes JA.

Departamento de Biologia Celular, Fisiologia e Inmunologia, Universidad de
Cordoba, Campus de Rabanales, Edificio Severo Ochoa, Planta 3, 14014 Cordoba,
Spain.

Onions (Allium cepa L.) treated with external ascorbic acid or with the
immediate precursor of its synthesis L/​galactono/​gamma/​lactone show a stimulated
elongation rate of the roots and an increase in the number of new radicles
appearing at the bulb base. Treatment with both molecules resulted in an
enhanced accumulation of ascorbate and dehydroascorbate along the root axis, but
the distribution of these redox forms was not uniform along the root, as
detected in intracellular (symplastic) and extracellular (apoplastic)
compartments. Thus, those radicular zones metabolically more active, such as the
meristem and the elongation zone, accumulated the highest amount of both redox
forms of ascorbate. On the other hand, ascorbate and L/​galactono/​gamma/​lactone
also stimulated cytosolic glucose/​6/​phosphate dehydrogenase activity and
inhibited peroxidase activity as deduced from in vivo and in vitro experiments.
Differences were also found when comparing apoplastic and symplastic activities.
These results are compatible with the idea of an ascorbate/​mediated stimulation
of root growth by inhibiting cell wall stiffening and increasing root
metabolism.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15582927 [PubMed /​ indexed for MEDLINE]

117: Food Chem Toxicol. 2005 Jan;43(1):57/​63.

Biochemical study on the hypoglycemic effects of onion and garlic in
alloxan/​induced diabetic rats.

El/​Demerdash FM, Yousef MI, El/​Naga NI.

Department of Environmental Studies, Institute of Graduate Studies and Research,
Alexandria University, 163, Horreya Avenue, P.O. Box 832, Alexandria 21526,
Egypt.

The present study was carried out to investigate the effects of onion (Allium
cepa Linn) and garlic (Allium sativum Linn) juices on biochemical parameters,
enzyme activities and lipid peroxidation in alloxan/​induced diabetic rats.
Alloxan was administered as a single dose (120 mg/kg BW) to induce diabetes. A
dose of 1 ml of either onion or garlic juices/100 g body weight (equivalent to
0.4 g/100 g BW) was orally administered daily to alloxan/​diabetic rats for four
weeks. The levels of glucose, urea, creatinine and bilirubin were significantly
(p<0.05) increased in plasma of alloxan/​diabetic rats compared to the control
group. Aspartate aminotransferase (AST), alanine aminotransferase (ALT), lactate
dehydrogenase (LDH), and alkaline and acid phosphatases (AlP, AcP) activities
were significantly (p<0.05) increased in plasma and testes of alloxan/​diabetic
rats, while these activities were decreased in liver compared with the control
group. Brain LDH was significantly (p<0.05) increased. The concentration of
thiobarbituric acid reactive substances and the activity of glutathione
S/​transferase in plasma, liver, testes, brain, and kidney were increased in
alloxan/​diabetic rats. Treatment of the diabetic rats with repeated doses of
either garlic or onion juices could restore the changes of the above parameters
to their normal levels. The present results showed that garlic and onion juices
exerted antioxidant and antihyperglycemic effects and consequently may alleviate
liver and renal damage caused by alloxan/​induced diabetes.

PMID: 15582196 [PubMed /​ indexed for MEDLINE]

118: Mutat Res. 2004 Nov;567(2/​3):227/​345.

Mutagens in contaminated soil: a review.

White PA, Claxton LD.

Mutagenesis Section, Safe Environments Program, Health Canada, Tunney's Pasture
0803A, Ottawa, Ont., Canada K1A 0L2. paul_white@hc/​sc.gc.ca

The intentional and accidental discharges of toxic pollutants into the
lithosphere results in soil contamination. In some cases (e.g., wood preserving
wastes, coal/​tar, airborne combustion by/​products), the contaminated soil
constitutes a genotoxic hazard. This work is a comprehensive review of published
information on soil mutagenicity. In total, 1312 assessments of genotoxic
activity from 118 works were examined. The majority of the assessments (37.6%)
employed the Salmonella mutagenicity test with strains TA98 and/or TA100. An
additional 37.6% of the assessments employed a variety of plant species (e.g.,
Tradescantia clone 4430, Vicia faba, Zea mays, Allium cepa) to assess mutagenic
activity. The compiled data on Salmonella mutagenicity indicates significant
differences (p<0.0001) in mean potency (revertents per gram dry weight) between
industrial, urban, and rural/agricultural sites. Additional analyses showed
significant empirical relationships between S9/​activated TA98 mutagenicity and
soil polycyclic aromatic hydrocarbon (PAH) concentration (r2=0.19 to 0.25,
p<0.0001), and between direct/​acting TA98 mutagenicity and soil dinitropyrene
(DNP) concentration (r2=0.87, p<0.0001). The plant assay data revealed excellent
response ranges and significant differences between heavily contaminated,
industrial, rural/agricultural, and reference sites, for the anaphase aberration
in Allium cepa (direct soil contact) and the waxy locus mutation assay in Zea
mays (direct soil contact). The Tradescantia assays appeared to be less
responsive, particularly for exposures to aqueous soil leachates. Additional
data analyses showed empirical relationships between anaphase aberrations in
Allium, or mutations in Arabidopsis, and the 137Cs contamination of soils.
Induction of micronuclei in Tradescantia is significantly related to the soil
concentration of several metals (e.g., Sb, Cu, Cr, As, Pb, Cd, Ni, Zn). Review
of published remediation exercises showed effective removal of genotoxic
petrochemical wastes within one year. Remediation of more refractory genotoxic
material (e.g., explosives, creosote) frequently showed increases in mutagenic
hazard that remained for extended periods. Despite substantial contamination and
mutagenic hazards, the risk of adverse effect (e.g., mutation, cancer) in humans
or terrestrial biota is difficult to quantify.

Publication Types:
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.
Review

PMID: 15572286 [PubMed /​ indexed for MEDLINE]

119: Fitoterapia. 2004 Dec;75(7/​8):645/​55.

Morphological evidences for onion/​induced growth inhibition of Trichophyton
rubrum and Trichophyton mentagrophytes.

Ghahfarokhi MS, Goodarzi M, Abyaneh MR, Al/​Tiraihi T, Seyedipour G.

Department of Mycology, Faculty of Medical Sciences, Tarbiat Modarres
University, Tehran, Iran. shamsm@@modares.ac.ir

The antifungal activity of onion (Allium cepa L.) on two important
dermatophytes, Trichophyton rubrum and Trichophyton mentagrophytes, with special
reference to morphological aspects was studied. Growth of both fungi was found
to be strongly inhibited by aqueous onion extract (AOE) as a dose/​dependent
manner. The extract showed fungicidal effect for both fungi at concentrations
>3.12% (v/v). The fungus T. mentagrophytes was more affected by the onion as
compared to T. rubrum at all concentrations used. Morphological effects of onion
exposure were examined in correlation with fungal growth. Corresponding to the
growth inhibition, light and electron microscopy observations revealed
morphological anomalies in hyphal compartments. The results demonstrated that
AOE targets the cell membrane of the fungi as breaking down of both inner and
outer membranes with consequent extrution of materials into the surrounding
medium. Cytoplasmic membranes and other membranous structures of organelles,
such as nuclei and mitochondria, were also disrupted. In correlation to the
fungal growth, morphological alterations occurred to a less content for T.
rubrum compared with T. mentagrophytes. The hyphae of T. rubrum were found to be
mainly affected by converting to resistant forms, i.e., chlamidospores as a
consequence of phenotype switching response to AOE. Plasmolysis accompanied by
an almost complete depletion and disorganization of cytoplasmic structures were
found to be the final event which led to cell death. Ultrastructural evidences
obtained from this study strongly support that morphological changes of T.
rubrum and T. mentagrophytes caused by AOE are associated with its fungistatic
and fungicidal activities. With respect to the morphological results and the
preliminary data on fungal biochemistry, a mechanism of action by interacting of
AOE with thiol (/​SH) groups present in essential compartments of the fungal
cells was postulated.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15567239 [PubMed /​ indexed for MEDLINE]

120: Biol Trace Elem Res. 2004 Dec;101(3):265/​76.

Selecting iodine/​enriched vegetables and the residual effect of iodate
application to soil.

Dai JL, Zhu YG, Zhang M, Huang YZ.

Research Center for Eco/​environmental Sciences, Chinese Academy of Sciences,
Beijing 100085, China.

A greenhouse pot experiment was conducted to select vegetables for iodine
uptake. The residual effect of iodate fertilization on the growth of and iodine
uptake by spinach plants were also investigated. Six vegetables, including leafy
vegetables (pakchoi [Brassica chinensis L.], spinach [Spinacia oleracea L.]),
tuber vegetables (onion [Allium cepa L.]), shoot vegetables (water spinach
[Ipomoea aquatica Forsk.], celery [Apium graveolens L.]), and root vegetables
(carrot [Daucus carota var. sativa DC.]) were examined. Results showed that the
concentrations of iodate in soil had significant effect on the biomass of edible
parts of pakchoi and spinach (p<0.01), whereas the concentrations of iodate in
soil had no significant effect on that of carrots, water spinach, celery, and
onion. Iodine concentrations in edible parts of vegetables and the transfer
factors (TFedible parts) of soil/​to/​edible parts of vegetables significantly
increased with increasing iodine concentrations in soil (p<0.001), and iodine
concentrations in edible parts and TFedible parts of spinach were much higher
than those of other vegetables at any treatment. Both transfer coefficients for
edible parts (TCedible parts) and for aerial parts (TCaerial parts) of
vegetables changed differently with increasing iodine concentrations in the
soil, and TCedible parts and TCaerial parts of spinach were higher than those of
other vegetables. Therefore, spinach was considered as an efficient vegetable
for iodine biofortification. Further experiment showed that there is
considerable residual effect of soil fertilization with iodate.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15564656 [PubMed /​ indexed for MEDLINE]

121: Rev Argent Microbiol. 2004 Jul/​Sep;36(3):139/​44.

[Microbiological study of dehydrated garlic (Allium sativum L.) and onion
(Allium cepa L.)]

[Article in Spanish]

Fuselli SR, Filsinger B, Fritz R, Yeannes MI.

Departamento de Quimica, Facultad de Ciencias Exactas y Naturales, Universidad
Nacional de Mar del Plata, Funes 3.350 (7600) Mar del Plata, Argentina.

A microbiological study during the process and the storage of garlic (Allium
sativum L.) and onion (Allium cepa L.) dehydrated, with the additional barriers
of blanching or brine immersion, was made. In all raw materials the average
counts of aerobic mesophilic bacteria expressed in CFU/g ranged from 1.2 x 10(2)
to 1.6 x 10(3), molds and yeasts from 60 to 1.6 x 10(3), Lactobacillus spp. and
Leuconostoc mesenteroides subsp. mesenteroides between 10 and 50. Microorganisms
identified were Penicillium spp., Monilia spp., Lactobacillus brevis,
Leuconostoc mesenteroides subsp. mesenteroides and yeasts in garlic; Mucor spp.,
Penicillium spp., Monilia spp., Lactobacillus brevis and yeasts in both types of
onions. Leuconostoc mesenteroides subsp. mesenteroides was detected in only kind
of onion. In dehydrated garlic storage, Penicillium spp., Monilia spp.,
Lactobacillus brevis and yeasts were detected. In garlic, when a blanching step
was carried out no microflora was detected. Mucor spp., Penicillium spp.,
Monilia spp. and Lactobacillus brevis were identified in both types of
dehydrated onions. When brine immersion was included the microflora detected was
significantly lower and only Penicillium spp. were found. The use of additional
barriers such as blanching or brine immersion produces an important effect on
the microbiological stability in these products.

Publication Types:
Comparative Study
English Abstract

PMID: 15559197 [PubMed /​ indexed for MEDLINE]

122: Plant Cell Rep. 2004 Nov;23(6):371/​6. Epub 2004 Jul 28.

Efficient plant regeneration from suspension cells of Allium cepa L.

Zhang W, Lin X, Takano H, Takio S, Ono K.

Graduate School of Science and Technology, Kumamoto University, Kurokami,
Kumamoto, 860/​8555, Japan.

Plant regeneration from calli of three cultivars of Allium cepa (Senshuki, O.Pki
and Shojovaka) was investigated. Callus was induced on four variations of BDS
medium containing different concentrations of 2,4/​dichlorophenoxyacetic acid
(2,4/​D) and 6/​benzyladenine (BAP). The regeneration frequency of calli of cvs.
Senshuki and O.Pki subcultured on solid MS medium supplemented with BAP ranged
from 50% to 80%; this frequency decreased to less than 30% after subculture in
the dark in liquid BDS medium. By repeating the dark/light transitions of the
culture protocol and by selecting for green cell clusters, we were able to
increase the regeneration frequency to more than 80% in all three cultivars.
These cell clusters maintained a high regeneration capacity in subsequent
subcultures in the absence of light for 2 months. Most (97%) of the regenerated
plantlets had a normal diploid karyotype (2 n=16) that was identical to that of
the mother plants, although 3% of the regenerated plants of cv. Shojovaka had a
tetraploid karyotype.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 15551136 [PubMed /​ indexed for MEDLINE]

123: J Nutr Biochem. 1999 Aug;10(8):477/​83.

Renal lesions in streptozotocin/​induced diabetic rats maintained on onion and
capsaicin containing diets.

Babu PS, Srinivasan K.

Department of Biochemistry and Nutrition, Central Food Technological Research
Institute, Mysore, India.

Onion (Allium cepa) powder and capsaicin, the pungent principle of red pepper
(Capsicum annum) were added in the amounts of 3 g% and 15 mg%, respectively, to
the diet of streptozotocin/​induced diabetic Wistar rats for 8 weeks. The
presence of renal lesions was assessed by the extent and quality of proteinuria
and by the leaching of renal tubular enzymes into the urine. Renal integrity was
assessed by measuring the activities in the kidney tissue of several key enzymes
of carbohydrate metabolism and of polyol pathway, transaminases, and ATPases.
Data on enzymuria and proteinuria, activities of kidney ATPases present in
diabetic patients, suggested that dietary onion caused significant beneficial
modulation of the progression of renal lesions in the diabetic rats. These
findings were also corroborated by histologic examination of kidney sections.
Dietary capsaicin did not have any favorable influence on renal pathology in
diabetes. It is inferred that this beneficial ameliorating influence of dietary
onion on diabetic nephropathy may be mediated through onion's ability to lower
blood cholesterol levels and to reduce lipid peroxidation.

PMID: 15539326 [PubMed]

124: Plant Physiol. 2004 Dec;136(4):4318/​25. Epub 2004 Nov 5.

Can Ca2+ fluxes to the root xylem be sustained by Ca2+/​ATPases in exodermal and
endodermal plasma membranes?

Hayter ML, Peterson CA.

Department of Biology, University of Waterloo, Waterloo, Ontario, Canada, N2L
3G1.

The pathway of Ca2+ movement from the soil solution into the root stele has been
a subject of controversy. If transport through the endodermis is assumed to be
through the cytoplasm, the limiting factor is believed to be the active pumping
of Ca2+ from the cytoplasm into the stele apoplast through the plasma membrane
lying on the stele side of the Casparian band. By analogy, for similar transport
through the exodermis, the limiting step would be the active pumping into the
apoplast on the central cortical side of the layer. Such effluxes are mediated
by Ca2+/​ATPases. To assess whether or not known Ca2+ fluxes to the stele in
onion (Allium cepa) roots could be supported by Ca2+/​ATPases, the percentages of
total membrane protein particles required to effect the transport were
calculated using measured values of membrane surface areas, an animal literature
value for Ca2+/​ATPase V(max), plant literature values for Ca2+/​ATPase K(m), and
protein densities of relevant membranes. Effects of a putative symplastic
movement of Ca2+ from the exo/​ or endodermis into the next cell layer, which
would increase the surface areas available for pumping, were also considered.
Depending on the assumptions applied, densities of Ca2+ pumps, calculated as a
percentage of total membrane protein particles, varied tremendously between
three and 1,600 for the endodermis, and between 0.94 and 1,900 for the
exodermis. On the basis of the data, the possibility of Ca2+ transport through
the cytoplasm and membranes of the exodermis and endodermis cannot be
discounted. Thus, it is premature to assign an entirely apoplastic pathway for
Ca2+ movement from the soil solution to the tracheary elements of the xylem. To
verify any conclusion with certainty, more detailed data are required for the
characteristics of exo/​ and endodermal Ca2+/​ATPases.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15531711 [PubMed /​ indexed for MEDLINE]

125: J Environ Biol. 2004 Apr;25(2):187/​90.

Demonstration of sperm head shape abnormality and clastogenic potential of
cypermethrin.

Kumar S, Gautam AK, Agarwal KR, Shah BA, Saiyad HN.

Division of Histochemistry and Reproductive Toxicology, National Institute of
Occupational Health (ICMR), Meghani Nagar, Ahemdabad/​380016, India.
sunilnioh@yahoo.com

Adult male Swiss albino mice were administered ip. suspension solution of
cypermethrin in 0.15% DMSO at the doses of 30 mg, 60 mg and 90 mg/kg b. wt.
daily for 5 days. Another group of animals was injected cyclophosphamide ip. (60
mg/kg b. wt.) in similar manner which served as positive control. Effect of
cypermethrin on body and testes weight and sperm head morphology was studied.
Clastogenic potential of cypermethrin was studied by using modified Allium test.
The cytological changes were studied in the root tip cells of Allium cepa after
3 days treatment with three different concentration of cypermethrin (0.1, 1.0
and 10.0 microg/ml). The results revealed that body weight gain was considerably
reduced in higher dose groups, but the testicular weight did not change
significantly in any of the cypermethrin treated groups. However, a significant
elevation in the number of abnormal shape of sperm head was noticed in higher
dose groups as compared to control. It was observed that the abnormality in the
shape of sperm head was dose/​dependent. The cytological changes in the root tip
cells of Allium cepa indicated that cypermethrin is having toxic effects on the
root tip cells in the form of stickiness of chromosomes and also affect the
mitotic activity. This study suggest that cypermethrin may have the potential to
induce adverse effects on sperm head shape morphology of mouse as well as
clastogenic effects on root tip cells of Allium cepa.

PMID: 15529877 [PubMed /​ indexed for MEDLINE]

126: Med Arh. 2004;58(4):206/​9.

[Genotoxicity evaluation of paracetamol applying Allium test]

[Article in Bosnian]

Aganovic/​Musinovic I, Todic M, Becic F, Kusturica J.

Centar za humanu gentiku, Medicinski fakultet Univerziteta u Sarajevu.

Paracetamol genotoxic potential was evaluated among different concentrations,
applying Allium test on Allium cepa. Total number of roots, number of dark
roots, the length of the longest root, the average root, and the shortest root
were determined. Statistically significant differences among total number of
roots (p > 0.05) was observed at concentrations of 50 microg/ml and 100
microg/ml, and highly statistically significant differences at concentrations of
5 microg/ml and 25 microg/ml, while at the highest concentration (400 microg/ml)
was observed statistically significant higher number of roots in comparation to
all other concentrations of paracetamol and control group. The results of
research suggest the concentrations of 5 microg/ml, 25 microg/ml and 400
microg/ml for further evaluation of paracetamol mutagenic potential.

Publication Types:
English Abstract

PMID: 15526585 [PubMed /​ indexed for MEDLINE]

127: J Agric Food Chem. 2004 Nov 3;52(22):6787/​93.

Varietal differences in phenolic content and antioxidant and antiproliferative
activities of onions.

Yang J, Meyers KJ, van der Heide J, Liu RH.

Department of Food Science and Institute of Comparative and Environmental
Toxicology, Stocking Hall, Cornell University, Ithaca, New York 14853, USA.

Epidemiological studies have indicated that the consumption of fruits and
vegetables is associated with a reduced risk for the development of chronic
diseases, such as cardiovascular disease and cancer. Phytochemicals, including
phenolics and flavonoids, are suggested to be the major bioactive compounds
contributing to the health benefits of fruits and vegetables. Onions are a major
source of dietary flavonoids; however, there may exist varietal differences in
composition, concentration, and beneficial activities. To characterize these
differences, shallots and 10 onion (Allium cepa L.) varieties commonly available
in the United States (Western Yellow, Northern Red, New York Bold, Western
White, Peruvian Sweet, Empire Sweet, Mexico, Texas 1015, Imperial Valley Sweet,
and Vidalia) were evaluated for total phenolic and flavonoid contents and
antioxidant and antiproliferative activities. Shallots contained the highest
total phenolic content (114.7 +//​ 10.0 mg/100 g of sample) among the varieties
tested, with a 6/​fold difference observed when compared to the variety with the
lowest phenolic content (Vidalia, p < 0.05). Western Yellow onion variety
exhibited the highest total flavonoid content (69.2 +//​ 3.7 mg/100 g of onion)
of the varieties tested, with an 11/​fold difference when compared to the variety
with the lowest flavonoid content (Western White, p < 0.05). Shallots exhibited
the highest total antioxidant activity (45.5 +//​ 2.1 micromol of vitamin C
equiv/g of onion), followed by Western Yellow, New York Bold, Northern Red,
Mexico, Empire Sweet, Western White, Peruvian Sweet, Texas 1015, Imperial Valley
Sweet, and Vidalia. For all varieties, both total phenolic and flavonoid
contents were strongly correlated with total antioxidant activity (R (2) =
0.9668, p < 0.05; and R (2) = 0.7033, p < 0.05, respectively). The proliferation
of HepG(2) and Caco/​2 cells was significantly inhibited in a dose/​dependent
fashion after exposure to the Western Yellow, shallots, New York Bold, and
Northern Red extracts, with Western Yellow, shallots, and New York Bold
exhibiting the highest antiproliferative activity against HepG(2) cells and New
York Bold and Western Yellow exhibiting the highest antiproliferative activity
against Caco/​2 cells. However, the varieties of Western White, Peruvian Sweet,
Empire Sweet, Mexico, Texas 1015, Imperial Valley Sweet, and Vidalia
demonstrated weak antiproliferative activity against both HepG(2) and Caco/​2
cells. These results may influence consumers toward purchasing onion varieties
exhibiting greater potential health benefits and may significantly affect future
breeding efforts to enhance onion nutritional qualities.

PMID: 15506817 [PubMed /​ indexed for MEDLINE]

128: Mol Genet Genomics. 2004 Nov;272(4):411/​9. Epub 2004 Oct 21.

Gold color in onions (Allium cepa): a natural mutation of the chalcone isomerase
gene resulting in a premature stop codon.

Kim S, Jones R, Yoo KS, Pike LM.

Vegetable & Fruit Improvement Center, Department of Horticultural Sciences,
Texas A&M University, College Station, TX 77845, USA.

Unusual gold/​colored onions were selected from a F3 family originating from a
cross between US/​type yellow and Brazilian yellow onions. HPLC analysis showed
that the gold onions contained a significantly reduced amount of quercetin, the
most abundant flavonoid in onions. This result indicated that an early step in
the flavonoid biosynthesis pathway might be abnormal in these onions. The
expression of flavonoid synthesis genes isolated from onions was examined in
gold onions and compared to that in onions of other colors by RT/​PCR. The
results showed that all genes were transcribed in gold onions as in red onions.
In order to identify any critical mutations in flavonoid synthesis genes
encoding enzymes involved in early steps of the pathway, the genomic sequence of
chalcone isomerase (CHI) was obtained. A premature stop codon and a subsequent
single base/​pair addition causing a frameshift were identified in the coding
region of the CHI gene in the gold onions. Co/​segregation of the mutant allele
of the CHI gene and the gold phenotype was investigated in the original F2
segregating population. Genotyping of three color groups (red, yellow and gold)
of F2 onions revealed perfect co/​segregation of the mutant CHI allele with the
gold phenotype. All tested gold F2 onions were homozygous for the mutant CHI
allele. This perfect co/​segregation implies that the presence of a premature
stop codon in the gold CHI gene results in an inactive CHI. Inactivation of CHI
results in a block in the flavonoid biosynthesis pathway and the accumulation of
chalcone derivatives, including a yellow pigment which might be responsible for
the gold color in onions.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 15503141 [PubMed /​ indexed for MEDLINE]

129: Mol Genet Genomics. 2004 Aug;272(1):18/​27. Epub 2004 Jul 28.

Pink (P), a new locus responsible for a pink trait in onions (Allium cepa)
resulting from natural mutations of anthocyanidin synthase.

Kim S, Binzel ML, Yoo KS, Park S, Pike LM.

Vegetable & Fruit Improvement Center, Department of Horticultural Sciences,
Texas A&M University, College Station, TX 77845, USA.

A new locus conditioning a pink trait in onions was identified. Unusual pink
onions were found in haploid populations induced from an F(1) hybrid between
yellow and dark red parents and in F(3) populations originating from the same
cross. Segregation ratios of red to pink in F(2), backcross, and F(3)
populations indicated that this pink trait is determined by a single recessive
locus. RT/​PCR was carried out to look for any differential expression of
anthocyanin synthesis genes between dark red and pink F(3) lines. The transcript
level of anthocyanidin synthase (ANS) was significantly reduced in the pink
line. To determine whether this reduced transcription is caused by other
regulatory factors or by mutations in the ANS gene itself, ANS gene sequences
from both dark red and pink F(3) lines were compared to detect any
polymorphisms. Polymorphisms were identified, and subsequently utilized as
molecular markers for the selection of ANS alleles. Absolute co/​segregation of
the pink allele and the ANS allele from the pink line was observed in parents,
F(1) and F(3) populations. These results indicate that reduced transcription of
the ANS gene caused by mutations in a cis /​acting element is likely to result in
the pink trait in onions.

Publication Types:
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 15480791 [PubMed /​ indexed for MEDLINE]

130: J Appl Toxicol. 2004 Sep/​Oct;24(5):401/​7.

Use of a complex approach for assessment of metamizole sodium and
acetylsalicylic acid toxicity, genotoxicity and cytotoxicity.

Arkhipchuk VV, Goncharuk VV, Chernykh VP, Maloshtan LN, Gritsenko IS.

Institute of Colloid Chemistry and Water Chemistry, boulevard Vernadsky 42,
03680 Kiev, Ukraine. arvic@nbi.com.ua

A complex approach based on the use of test organisms belonging to different
systematic groups (plants, invertebrates and vertebrates), as well as the
nucleolar biomarker and the micronucleus test on their cells, was applied to
assess the toxicity, cytotoxicity and genotoxicity of two pharmaceutical
substances (metamizole sodium and acetylsalicylic acid) applied at ic(50)
concentrations for mammalian cells. The compound acetylsalicylic acid was
evaluated at a concentration (1.6 x 10(3) mg l(/​1)) that was non/​toxic for
bioassays based on fish (Carassius auratus gibelio) and hydra (Hydra attenuata)
and acutely toxic for bioassays with ceriodaphnia (Ceriodaphnia affinis) and
onion (Allium cepa). The metamizole sodium solution (6.25%) demonstrated acute
toxicity for the whole set of test organisms. Both drugs, after their 30/​360 min
influence on the test organisms, first changed the nucleolar size in plant and
animal cells (i.e. the transcriptional activity of ribosomal genes was affected
most significantly). Moreover, the metamizole sodium solution caused nucleolar
structural damage in 90% of hydra cells as early as after 30 min of exposure.
The acetylsalicylic acid solution inhibited essentially the rate of cell
division in the meristem of onion roots (the mitotic index decreased to 9.6 per
thousand, as compared 51.7 per thousand for the control). The carp incubation
and the onion germination in the acetylsalicylic acid solution showed a
reproducible increase in the frequency of cells with micronuclei (2 and 5.5
times, respectively) and double nuclei (3 and 1.5 times, respectively). The
approach described herein may be applied for obtaining rapid, cost/​efficient and
useful supplementary data on different types of toxicity for marketed drugs as
well as for drugs under development.

PMID: 15478170 [PubMed /​ indexed for MEDLINE]

131: Indian J Exp Biol. 2004 Sep;42(9):893/​9.

Evaluation of antimitotic activity of Rotula aquatica (Lour): a traditional herb
used in treatment of cancer.

Patil S, Narayanan S, Eibl G, Jolly CI.

Department of Pharmacognosy and Phytochemistry, Prin K M Kundnani College of
Pharmacy, 47, R G Thadani Marg, Worli, Mumbai 400 018, India. s_patil@vsnl.com

Rotula aquatica was extensively used by vaidyas (Ayurvedic practioners) in
holistic treatment of cancer. In the present study, an attempt has been made to
evaluate the antimitotic activity of R. aquatica. Preliminary antimitotic
screening was done using Allium cepa root tip assay. The mitotic index of the
root tips markedly decreased with increasing concentration of the aqueous
extract. The different fractions obtained by successive extraction of R.
aquatica using solvents of increasing polarity were also evaluated for their
antimitotic activity. Tannins were isolated which showed a better activity than
the non/​tannin fraction. Experiments were also carried out with incorporation of
folic acid in the aqueous extract. Folic acid inhibited the antimitotic activity
of aqueous extract of R. aquatica in a dose dependent manner. The results
obtained were compared with methotrexate/​/​a known drug available in market as
anti/​cancer agent. The studies were extended to human cells using 3 pancreatic
cancer cell lines, viz: HPAF/​II, BxPC/​3, and CAPAN/​2. Extract of R. aquatica was
found to be extremely effective in the prevention of cell proliferation of the
pancreatic cancer cell lines. The phytochemical evaluation revealed presence of
polyphenols (tannins) and steroids. A HPTLC fingerprinting was developed and
studied. Two compounds were isolated and subjected to spectral studies like UV,
IR and mass spectrums. The empirical formula was derived by considering this
data with elemental analysis of the compounds.

Publication Types:
Comparative Study

PMID: 15462182 [PubMed /​ indexed for MEDLINE]

132: J Biosci. 2004 Sep;29(3):329/​35.

Subcellular localization of cadmium in the root cells of Allium cepa by electron
energy loss spectroscopy and cytochemistry.

Liu D, Kottke I.

Department of Biology, College of Chemistry and Life Sciences, Tianjin Normal
University, 300074, People's Republic of China. donghua@mail.zlnet.com.cn

The ultrastructural investigation of the root cells of Allium cepa L. exposed to
1 mM and 10 mM cadmium (Cd) for 48 and 72 h was carried out. The results
indicated that Cd induced several obvious ultrastructural changes such as
increased vacuolation, condensed cytoplasm with increased density of the matrix,
reduction of mitochondrial cristae, severe plasmolysis and highly condensed
nuclear chromatin. Electron dense granules appeared between the cell wall and
plasmalemma. In vacuoles, electron dense granules encircled by the membrane were
aggregated and formed into larger precipitates, which increase in number and
volume as a consequence of excessive Cd exposure. Data from electron energy loss
spectroscopy (EELS) confirmed that these granules contained Cd and showed that
significantly higher level of Cd in vacuoles existed in the vacuolar
precipitates of meristematic or cortical parenchyma cells of the differentiating
and mature roots treated with 1 mM and 10 mM Cd. High levels of Cd were also
observed in the crowded electron dense granules of nucleoli. However, no Cd was
found in cell walls or in cells of the vascular cylinder. A positive
Gomori/​Swift reaction showed that small metallic silver

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15381854 [PubMed /​ indexed for MEDLINE]

133: Int J Food Sci Nutr. 2004 Jun;55(4):325/​31.

Effect of temperature on soluble invertase activity, and glucose, fructose and
sucrose status of onion bulbs (Allium cepa) in store.

Benkeblia N, Onodera S, Yoshihira T, Kosaka S, Shiomi N.

Department of Food and Nutrtion Sciences, Rakuno Gakuen University, Ebetsu,
Hokkaido, Japan. ben/​nour@rakuno.ac.jp

The activity of soluble invertase, and the variation in glucose, fructose and
sucrose contents in onion bulbs (Allium cepa) during long/​term storage at 10
degrees C and 20 degrees C were investigated. Invertase activity increased
progressively after 8 weeks to 0.084 and 0.092 nkat/g fresh weight (FW), then
sharply to 0.29 and 0.35 nkat/g FW at 20 degrees C and 10 degrees C,
respectively, and remained high during 5 weeks. Then, activity decreased
abruptly to 0.039 and 0.041 nkat/g, and remained low during the last 8 weeks and
close to that observed initially. Glucose increased to 17.73 and 14.62 mg/g FW
after 4 weeks at 20 degrees C and 10 degrees C, respectively, then decreased
sharply between week 5 and week 7 to 4.13 and 4.91 mg/g FW, respectively, and
remained rather stable ranging from 9 and 10 mg/g FW at both temperatures.
Fructose showed a similar pattern and was 14.8 and 21.68 mg/g FW at 20 degrees C
and 10 degrees C, respectively. Between week 10 and week 24, fructose ranged
from 5 and 6 mg/g FW, and from 6 and 7 mg/g FW at 20 degrees C and 10 degrees C,
respectively. Sucrose increased to 19.63 and 14.43 mg/g FW at 20 degrees C and
10 degrees C, respectively, decreased during 3 weeks, and then increased
randomly from 5.69 to 9.42 mg/g FW at 20 degrees C, but remained in a steady
state at 10 degrees C ranging 5.03 +//​ 0.78 mg/g FW. During the last 6 weeks,
the sucrose content was higher at 20 degrees C than at 10 degrees C. The
fructose/​glucose ratio varied during the first 8 weeks but remained at a steady
level during the last 16 weeks. The (glucose+fructose)/sucrose ratio increased
randomly at 10 degrees C, whereas at 20 degrees C the ratio increased during 10
weeks then decreased progressively during the final 14 weeks.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 15369986 [PubMed /​ indexed for MEDLINE]

134: Thromb Res. 2004;114(3):213/​20.

An onion variety has natural antithrombotic effect as assessed by
thrombosis/thrombolysis models in rodents.

Yamada K, Naemura A, Sawashita N, Noguchi Y, Yamamoto J.

Laboratory of Physiology, Faculty of Nutrition, Kobe Gakuin University, Nishi,
651/​2180, Japan.

INTRODUCTION: Prevention of arterial thrombotic diseases has a high priority in
developed countries. As inappropriate diet has been shown to be an important
risk factor for thrombotic events, regular antithrombotic diet may offer a
convenient and effective way of prevention. The aim of the present study was to
test onion extracts for antithrombotic effect and to identify the effective
varieties in Allium cepa. MATERIALS AND METHODS: A shear/​induced platelet
function test (haemostatometry) was used to screen for antithrombotic potential.
Onion extracts showing significant antithrombotic activity in vitro were further
assessed in vivo by using a laser/​induced thrombosis test in mice. RESULTS AND
CONCLUSIONS: An onion variety, Toyohira, showed significant antithrombotic
activity both in vitro and in vivo. Toyohira showed thrombolytic activity in
addition to the antiplatelet effect. Superkitamomiji, 2935A, and K83211 showed
only thrombolytic activity. Quercetin, the richest flavonoid in onion, was
measured, but no correlation was found between quercetin content and
antithrombotic activity. It is concluded that onion A. cepa can be classified
into varieties with or without antithrombotic and thrombolytic effects. This
should be taken into account in future population studies on the antithrombotic
effects of vegetables.

Publication Types:
Comparative Study
Evaluation Studies

PMID: 15342218 [PubMed /​ indexed for MEDLINE]

135: Mycol Res. 2004 Jun;108(Pt 6):610/​5.

Possible involvement of hyphal phosphatase in phosphate efflux from intraradical
hyphae isolated from mycorrhizal roots colonized by Gigaspora margarita.

Kojima T, Saito M.

Soil Ecology Laboratory, Department of Grassland Ecology, National Institute of
Livestock and Grassland Science, Senbonmatsu 768, Nishinasuno, Tochigi 329/​2793,
Japan. kojima@naro.affrc.go.jp

We developed a method for separating physiologically active intraradical hyphae
of arbuscular mycorrhizal (AM) fungi from mycorrhizal roots, allowing the hyphae
to be used for physiological and biochemical experiments. In the present study,
the phosphate efflux from the intraradical hyphae in vitro was examined in
relation to hyphal phosphatase activity. Onion seedlings (Allium cepa) were
planted in the soil inoculated with Gigaspora margarita. Six weeks after
transplanting, the intraradical hyphae were isolated from the mycorrhizal roots
using plant cell/​wall digestion enzymes. The hyphae were incubated briefly at 25
degrees C in a buffer solution (50 mM Tris/HCl, pH 7.4), then incubated for 2 h
and gently shaken with various inhibitors. Phosphate efflux, the amount of
phosphate released to the buffer, was analysed by EnzChek phosphate assay kit.
Hyphal phosphatase activity was stained histochemically and the proportion of
phosphatase/​active arbuscules was examined for each inhibitor. Phosphate
effluxes were to some degree reduced by all inhibitors used, while the
phosphatase inhibitor, BeSO4, greatly reduced the efflux. The degree of
inhibition in the arbuscular phosphatase by each chemical was closely correlated
to the decrease in the phosphate efflux. These results suggest that hyphal
phosphatase may be partially involved in the phosphate efflux process from
intraradical hyphae.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15323242 [PubMed /​ indexed for MEDLINE]

136: J Agric Food Chem. 2004 Aug 25;52(17):5499/​505.

Chemical characterization of interspecific hybrids between Allium cepa L. and
Allium kermesinum Rchb.

Storsberg J, Schulz H, Keusgen M, Tannous F, Dehmer KJ, Keller ER.

Federal Centre for Breeding Research on Cultivated Plants, Institute for Plant
Analysis (BAZ), Neuer Weg 22/23, D/​06484 Quedlinburg, Germany.

Interspecific hybridization between wild and cultivated species of the genus
Allium has been performed to generate plant material possessing biochemical
properties of both parental plants. These cross/​breeding experiments should lead
to Allium plants with higher amounts of valuable constituents. The chemical
characterization of interspecific hybrids between A. cepa and A. kermesinum is
described on the basis of their sulfur/​containing constituents and secondary
metabolites. In addition, the hybrid character has been proven by random
amplified polymorphic DNA (RAPD) analysis of the progenies obtained from the
crosses. It has been shown that the distribution of the cysteine sulfoxides as
well as the volatile secondary metabolites in the hybrids is not uniform. The
profiles are mainly determined by the paternal wild species A. kermesinum. It
has been ascertained that the gas chromatography profiles of the hybrids show
increasing amounts of unsymmetrical substituted oligosulfides, which are known
to be physiologically active substances. On the basis of statistical
calculations, three different types of hybrids can be separated. The chemical
analysis of cysteine sulfoxides and volatile sulfur/​containing substances is
shown to be a useful tool for breeding purposes as it allows an effective
selection with regard to optimal distribution and amount of valuable
constituents.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15315391 [PubMed /​ indexed for MEDLINE]

137: J Agric Food Chem. 2004 Aug 25;52(17):5383/​90.

Erratum in:
J Agric Food Chem. 2005 Aug 10;53(16):6564.

Evaluation of carbohydrates in Pukekohe Longkeeper and Grano cultivars of Allium
cepa.

O'Donoghue EM, Somerfield SD, Shaw M, Bendall M, Hedderly D, Eason J, Sims I.

Crop & Food Research Limited, Private Bag 11 600, Palmerston North, New Zealand.
Odonoghuee@crop.cri.nz

The storage, soluble, and structural carbohydrates of two onion cultivars, the
hard, pungent Pukekohe Longkeeper (PLK) and the softer, milder Houston Grano,
were analyzed to determine differences that might be related to their response
to sulfur nutrition received during growth as well as their postharvest
attributes and end/​use suitability. PLK tissue contained 1.37 times more dry
matter than Grano and was composed of more fructan and sucrose and less glucose
and fructose than Grano [corrected] There were also differences in neutral sugar
content, especially galactose, and the amount, size, and content of pectin
fractions soluble in chelator and weak alkali. These two onion cultivars
differed in their capacity to take up sulfur, but there was no statistical
association between sulfur supply and any measured dry matter component.

PMID: 15315374 [PubMed /​ indexed for MEDLINE]

138: Planta. 2004 Dec;220(2):262/​70. Epub 2004 Aug 5.

The ethylene/​, jasmonate/​, abscisic acid/​ and NaCl/​responsive tomato
transcription factor JERF1 modulates expression of GCC box/​containing genes and
salt tolerance in tobacco.

Zhang H, Huang Z, Xie B, Chen Q, Tian X, Zhang X, Zhang H, Lu X, Huang D, Huang
R.

The National Plant Gene Research Center (Beijing), Biotechnology Research
Institute, Chinese Academy of Agricultural Sciences, 100081 Beijing, China.

Ethylene responsive factors (ERFs) are important plant/​specific transcription
factors, some of which have been demonstrated to interact with the
ethylene/​responsive GCC box and the dehydration/​responsive element (DRE);
however, data on the roles of ERF proteins in connection with various signaling
pathways are limited. In this research, we used the GCC box, an essential
cis/​acting element responsive to ethylene and methyl jasmonate (MeJA), as bait
in a yeast one/​hybrid system to isolate transcription factors from tomato
(Lycopersicon esculentum Mill.). One of the cDNAs, which was designated
Jasmonate and Ethylene Response Factor 1 (JERF1), encodes an ERF protein,
containing a conserved ERF DNA/​binding motif and functioning as a
transcriptional activator in yeast through targeting to the nucleus in onion
(Allium cepa L.) epidermal cells. Biochemical analysis revealed that JERF1 bound
not only to the GCC box but also to the DRE sequence. Expression of the JERF1
gene in tomato was induced by ethylene, MeJA, abscisic acid (ABA) and salt
treatment, indicating that JERF1 might act as a connector among different signal
transduction pathways. Further research with transgenic JERF1 tobacco (Nicotiana
tabacum L.) plants indicated that overexpressing JERF1 activated expression of
GCC box/​containing genes such as osmotin, GLA, Prb/​1b and CHN50 under normal
growth conditions, and subsequently resulted in enhanced tolerance to salt
stress, suggesting that JERF1 modulates osmotic tolerance by activation of
downstream gene expression through interaction with the GCC box or DRE.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15300440 [PubMed /​ indexed for MEDLINE]

139: Indian J Exp Biol. 2003 Jan;41(1):88/​90.

Effect of onion (Allium cepa Linn.) and garlic (Allium sativum Linn.) on plasma
triglyceride content in Japanese quail (Coturnix coturnix japonicum).

Kumar VG, Surendranathan KP, Umesh KG, Gayathri Devi DR, Belwadi MR.

Department of Veterinary Physiology, Veterinary College, Hebbal, Bangalore 560
024, India. kumargir@yahoo.com

Dietary onion and garlic caused an increase in the level of plasma triglyceride
which could be due to insulin like activity of dietary alliums and other factors
that promote lipogenesisi in growing stages. Changes in the plasma triglyceride
level in the control group due to change in age and sex were also noted. The
triglyceride level was more in female birds when compared to males of similar
age group. The plasma trigelyceride level increased with age in both sex except
for the level being similar in the 6 and 9/​week old females and 3 and 6/​week old
male birds. The results suggest that the effects of alliums in growing and adult
stages may be different which needs further study.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15267143 [PubMed /​ indexed for MEDLINE]

140: Ecotoxicol Environ Saf. 2004 Sep;59(1):123/​6.

A comparative toxicologic and genotoxic study of the herbicide arsenal, its
active ingredient imazapyr, and the surfactant nonylphenol ethoxylate.

Grisolia CK, Bilich MR, Formigli LM.

Departamento de Genetica e Morfologia, Instituto de Ciencias Biologicas,
Universidade de Brasilia, 70910/​900 Brasilia, DF, Brazil. grisolia@unb.br

The herbicide arsenal 250 NA, its technical/​grade active ingredient imazapyr,
and the surfactant nonylphenol ethoxylate (NP) were evaluated through
genotoxicity and toxicity studies in different organisms. A comparative study of
these three compounds was carried out to assess how the addition of surfactant
components may pose the highest toxicological risk to pesticide formulations.
The results showed that arsenal, imazapyr, and NP did not cause chromosome
aberration in Allium cepa nor increase the frequency of micronuclei in mice.
However, toxicological evaluations showed that NP was the most toxic compound to
mice, A. cepa, Drosophila melanogaster, and Biomphalaria tenagophila. In this
evaluation, it was observed that the adverse effects were produced by the
surfactant additive of the pesticide formulation. Copyright 2004 Elsevier Inc.

Publication Types:
Comparative Study

PMID: 15261733 [PubMed /​ indexed for MEDLINE]

141: J Exp Bot. 2004 Aug;55(404):1821/​30. Epub 2004 Jul 2.

Impact of pedospheric and atmospheric sulphur nutrition on sulphur metabolism of
Allium cepa L., a species with a potential sink capacity for secondary sulphur
compounds.

Durenkamp M, De Kok LJ.

Laboratory of Plant Physiology, University of Groningen, PO Box 14, 9750 AA
Haren, The Netherlands.

Onion (Allium cepa L.) was able to use atmospheric H(2)S as sole sulphur source
for growth. The foliarly absorbed H(2)S was rapidly metabolized into
water/​soluble, non/​protein thiol compounds, including cysteine, and subsequently
into other sulphur compounds in the shoots. In H(2)S/​exposed plants, the
accumulation of sulphur compounds in the shoots was nearly linear with the
concentration (0.15/​0.6 microl l(/​1)) and duration of the exposure. Exposure of
onion to H(2)S for up to 1 week did not affect the sulphur content of the roots.
Secondary sulphur compounds formed a sink for the foliarly absorbed sulphide,
and the sulphur accumulation upon H(2)S exposure could, for a great part, be
ascribed to enhancement of the content of gamma/​glutamyl peptides and/or
alliins. Furthermore, there was a substantial increase in the sulphate content
in the shoots upon H(2)S exposure. The accumulation of sulphate originated both
from the pedosphere and from the oxidation of absorbed atmospheric sulphide,
and/or from the degradation of accumulated secondary sulphur compounds. From
studies on the interaction between atmospheric and pedospheric sulphur nutrition
it was evident that H(2)S exposure did not result in a down/​regulation of the
sulphate uptake by the roots.

PMID: 15234992 [PubMed /​ indexed for MEDLINE]

142: J Exp Bot. 2004 Aug;55(404):1903/​18. Epub 2004 Jul 2.

Biosynthesis of the flavour precursors of onion and garlic.

Jones MG, Hughes J, Tregova A, Milne J, Tomsett AB, Collin HA.

School of Biological Sciences, The Biosciences Building, The University of
Liverpool, Liverpool L69 7ZB, UK. m.g.jones@liv.ac.uk

Onion (Allium cepa), garlic (A. sativum) and other Alliums are important because
of the culinary value of their flavours and odours. These are characteristic of
each species and are created by chemical transformation of a series of volatile
sulphur compounds generated by cleavage of relatively stable, odourless,
S/​alk(en)yl cysteine sulphoxide flavour precursors by the enzymes alliinase and
lachrymatory/​factor synthase. These secondary metabolites are S/​methyl cysteine
sulphoxide (MCSO, methiin; present in most Alliums, some Brassicaceae), S/​allyl
cysteine sulphoxide (ACSO, alliin; characteristic of garlic),
S/​trans/​prop/​1/​enyl cysteine sulphoxide (PECSO, isoalliin; characteristic of
onion), and S/​propyl cysteine sulphoxide (PCSO, propiin; in onion and related
species). Information from studies of the transformation of putative
biosynthetic intermediates, radiolabelling, and from measurements of sulphur
compounds within onion and garlic have provided information to suggest a
biosynthetic pathway. This may involve alk(en)ylation of the cysteine in
glutathione, followed by cleavage and oxidation to form the alk(en)yl cysteine
sulphoxide flavour precursors. There is also evidence that synthesis of the
flavour precursors may involve (thio)alk(en)ylation of cysteine or a precursor
such as O/​acetyl serine. Both routes may occur depending on the physiological
state of the tissue. There are indications from the effects of environmental
factors, such as the availability of sulphur, that control of the biosynthesis
of each flavour precursor may be different. Cysteine and glutathione metabolism
are discussed to indicate parallels with Allium flavour precursor biosynthesis.
Finally, possible avenues for exploration to determine the origin in planta of
the alk(en)yl groups are suggested.

Publication Types:
Research Support, Non/​U.S. Gov't
Review

PMID: 15234988 [PubMed /​ indexed for MEDLINE]

143: Protoplasma. 2004 Jun;223(2/​4):191/​6. Epub 2004 Apr 21.

HSP90 and checkpoint/​dependent lengthening of the G2 phase observed in plant
cells under hypoxia and cold.

Gimenez/​Abian MI, Rozalen AE, Carballo JA, Botella LM, Pincheira J, Lopez/​Saez
JF, de la Torre C.

Centro de Investigaciones Biologicas, Consejo Superior de Investigaciones
Cientificas, Ramiro de Maeztu 9, 28040 Madrid, Spain.

Proliferating cells of Allium cepa L. roots became adapted to hypoxia (5%
oxygen) and cold (10 degrees C) by acquiring new steady/​state kinetics of
growth. The cell cycle time increased from the 17.6 h in control meristems up to
29.7 and 69.0 h under hypoxia and cold conditions, respectively. Acclimation of
the proliferating cells was stress specific. No acclimation took place after 24
h of heat treatment (40 degrees C). Under cold treatment, all cycle phases
enlarged uniformly. However, under hypoxia, while the G(1) and S cycle phases
roughly doubled in their timing, the expected checkpoint/​dependent lengthening
of G(2) did not take place. This failure in lengthening G(2) in response to
hypoxia correlated with a failure in the overinduction of a single peptide with
a molecular mass of about 134 kDa which is among those recognised by an HSP90
antibody. Moreover, the presence of this large peptide of the HSP90 family
proved to be a marker for cell proliferation. It was always absent from the
contiguous differentiated cells of the root. Lastly, the mitochondrial
chaperonin recognized by an HSP60 antibody in these roots not involved in
photosynthesis was always higher in the proliferating than in the
nonproliferating cells.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15221524 [PubMed /​ indexed for MEDLINE]

144: Cell Struct Funct. 1999 Oct;24(5):419/​24.

Loosening of a preprophase band of microtubules in onion (Allium cepa L.) root
tip cells by kinase inhibitors.

Nogami A, Mineyuki Y.

Department of Biological Science, Faculty of Science, Hiroshima University,
Kagamiyama 1/​3/​1, Higashi/​Hiroshima 739/​8526, Japan.

Effects of kinase inhibitors on the preprophase band of microtubules in onion
(Allium cepa L.) root tip cells were examined. Bundled microtubules in
preprophase bands were dispersed on the cell cortex when onion seedlings were
incubated with 2.5/​5.0 mM 6/​dimethylaminopurine. Fifteen min was enough for the
bundled microtubules to disappear. Although many preprophase bands remained when
the seedlings were incubated with 60 microM staurosporin, these preprophase band
microtubules were loosened and the width of the band became broad. These results
sugget that some kinases are involved in the microtubule bundling in the
preprophase band development.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15216900 [PubMed /​ indexed for MEDLINE]

145: J Agric Food Chem. 2004 Jun 30;52(13):4101/​8.

Low molecular weight phenols from the bioactive aqueous fraction of Cestrum
parqui.

D'Abrosca B, DellaGreca M, Fiorentino A, Monaco P, Zarrelli A.

Dipartimento di Scienze della Vita, Seconda Universita di Napoli, Via Vivaldi
43, I/​81100 Caserta, Italy.

The aqueous fraction of fresh leaves of Cestrum parqui and its organic fractions
have been assayed for their phytotoxicity on Lactuca sativa, Lycopersicon
esculentum, and Allium cepa. The tests showed that the bioactivity was retained
in the organic fractions. Chromatographic processes led to isolation and
characterization of the N/​(p/​carboxymethylphenyl)/​p/​hydroxybenzamide together
with 17 low molecular weight phenols and 2 flavones. The phytotoxicity tests
showed a good activity of these compounds on the target species. Comparison of
some metabolites with commercial herbicides revealed a major activity of the
natural compounds at lower concentrations.

Publication Types:
Comparative Study

PMID: 15212454 [PubMed /​ indexed for MEDLINE]

146: Chemosphere. 2004 Jul;56(4):387/​93.

Photoinduced toxicity of fluoranthene on germination and early development of
plant seedling.

Kummerova M, Kmentova E.

Faculty of Science, Department of Plant Physiology and Anatomy, Masaryk
University, Kotlarska 2, 611 37 Brno, Czech Republic. kumerova@sci.muni.cz

The influence of light on phytotoxicity of increased concentration (2, 5, 10
mg/l) of intact fluoranthene (FLT) and photomodified fluoranthene (phFLT)
diluted in experimental solutions was investigated. The germination rate of
lettuce (Lactuca sativa L.), onion (Allium cepa L.) and tomato (Lycopersicum
esculentum L.) seeds and some parameters of seedlings primary growth of these
plant species were used as laboratory indicators of phytotoxicity. Among them a
length of root and shoot, their dry weight and a content of photosynthetic
pigments in shoot were measured. The results demonstrated that the higher
concentration (5 and 10 mg/l) of FLT and especially of phFLT significantly
inhibited the germination rate of seeds and the length of root and shoot
seedlings of all plant species. Decreased production of biomass expressed by dry
weight of root and shoot was found in lettuce seedlings under the inhibitory
effect of FLT and phFLT. An increased concentration of FLT and phFLT did not
exhibit an unambiguous effect on the content of photosynthetic pigments in shoot
of experimental plants. Only the highest concentration (10 mg/l) of FLT
significantly increased content of chlorophylls a and b in lettuce, onion and
tomato plants and content of carotenoids in lettuce and onion. Light intensified
a significant inhibitory effect of phFLT in the most testified parameters of
germination and seedling growth.

Publication Types:
Comparative Study

PMID: 15184002 [PubMed /​ indexed for MEDLINE]

147: J Agric Food Chem. 2004 Jun 2;52(11):3345/​9.

Phytotoxins from the leaves of Ruta graveolens.

Hale AL, Meepagala KM, Oliva A, Aliotta G, Duke SO.

Department of Pharmacognosy, University of Mississippi, University, Mississippi
38677, USA.

Bioassay/​guided fractionation of the ethyl acetate extract of Ruta graveolens
(common rue) leaves led to the isolation of the furanocoumarins
5/​methoxypsoralen (5/​MOP), 8/​methoxypsoralen (8/​MOP), and the quinolone alkaloid
graveoline as phytotoxic constituents. Graveoline and 8/​MOP substantially
inhibited growth of Lactuca sativa (lettuce) seedlings and reduced chlorophyll
content at 100 microM; this effect was not due to a direct effect on chlorophyll
synthesis. Radical growth of L. sativa was inhibited by 10 microM 8/​MOP.
Graveoline inhibited growth of Lemna paucicostata (duckweed) at 100 microM. This
is the first report of the phytotoxic activity of graveoline. Growth of Agrostis
stolonifera (bentgrass) was inhibited by 5/​MOP at 30 microM. All three compounds
substantially reduced cell division in Allium cepa (onion) at or below 100
microM. None of the compounds caused significant cellular leakage of Cucumis
sativus (cucumber) cotyledon disks at 100 microM. All three compounds inhibit
plant growth, at least partially through inhibition of cell division.

PMID: 15161195 [PubMed /​ indexed for MEDLINE]

148: Eur J Histochem. 2004;48(1):49/​56.

Z/​DNA, a new in situ marker for transcription.

Cerna A, Cuadrado A, Jouve N, Diaz de la Espina SM, De la Torre C.

Institute of Experimental Botany, ASCR, Prague, Czech Republic.

Z/​DNA forms transiently behind the active RNA polymerases, because of the
mechanical torsional stress produced during transcription. In this paper, we
explore the possibility that the distribution of Z/​DNA stretches signals the
sites related to nuclear transcription. To localize transcription, the in situ
assay for active RNA polymerases, that allows the elongation of the already
initiated transcripts but no initiation of new ones (run/​on experiments), was
carried out in isolated nuclei of Allium cepa L. root meristems. Both nucleolar
and non/​nucleolar sites appeared labelled. Nucleoli were most active in
transcription than the multiple non/​nucleolar foci altogether. In situ
immunodetection of Z/​DNA provided images that were comparable to those obtained
after the run/​on assay, with one exception: while Z/​DNA and transcription sites
were scattered throughout the whole nucleus, Z/​DNA also accumulated in the
nuclear periphery, where no transcription foci were detected in run/​on assays.
The peripheral Z/​conformation signals might correspond to dsRNA segments present
in the pre/​mRNA in the process of their export to cytoplasm. The Z/​containing
structures nearly disappeared when non/​nucleolar RNA polymerase II/​dependent
transcription had been previously abolished by the adenosine analogue DRB
(5,6/​dichloro/​1/​beta/​D/​ribofuranosylbenzimidazole). This inhibition selectively
decreased the amount of all nucleoplasmic Z structures. On the other hand, the
inhibition of the nucleolar RNA polymerase I by cordycepin (3'/​deoxyadenosine)
prevented the presence of Z/​DNA in nucleoli. We propose to use the in situ
immunodetection of Z/​DNA as a marker of the transcription level in both
nucleolus and non/​peripheral nucleoplasmic regions of nuclei. Co/​detection of
Z/​DNA and of intermediate filament (IF) proteins, the major components of the
nuclear matrix, was also carried out. The IFA antibody recognizes a conserved
epitope essential for dimerization of the multiple IF proteins. They
co/​localized with most nucleolar Z/​DNA, but not with the nucleoplasmic ones. In
the nuclear periphery, the Z/​positive signals were adjacent to the IF proteins
constituting the lamina, though both signals did not often co/​localize.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15145775 [PubMed /​ indexed for MEDLINE]

149: J Agric Food Chem. 2004 May 19;52(10):2797/​802.

Quantitation of the intense aroma compound 3/​mercapto/​2/​methylpentan/​1/​ol in raw
and processed onions (Allium cepa) of different origins and in other Allium
varieties using a stable isotope dilution assay.

Granvogl M, Christlbauer M, Schieberle P.

Institut fur Lebensmittelchemie der Technischen Universitat Munchen,
Lichtenbergstrasse 4, D/​85748 Garching, Germany.

A stable isotope dilution assay was developed for the quantitation of the potent
onion odorant 3/​mercapto/​2/​methylpentan/​1/​ol (1) using mass chromatography and
synthesized [(2)H(2)]/​3/​mercapto/​2/​methylpentan/​1/​ol as the internal standard.
Application of the newly developed method on onions from different origins
revealed amounts between 8 and 32 microg/kg in raw onions, whereas 34/​246 microg
was found in sliced, stored (50 min), and then cooked onions. In extracts
prepared by simultaneous steam distillation/​extraction the highest
concentrations of 1 were formed, amounting to >1200 microg/kg. The much higher
content of 3/​mercapto/​2/​methylpentan/​1/​ol in cooked onions suggested its
formation from specific, yet unkown, precursors enzymatically formed during
cutting of raw onions. 1 was for the first time identified and also quantified
in other Allium species such as chives, scallions, and leek, whereas
surprisingly garlic and bear's garlic did not contain the aroma compound.

PMID: 15137816 [PubMed /​ indexed for MEDLINE]

150: J Pept Sci. 2004 Mar;10(3):173/​7.

Isolation of allicepin, a novel antifungal peptide from onion (Allium cepa)
bulbs.

Wang HX, Ng TB.

Department of Microbiology, College of Biological Science, China Agricultural
University, Beijing.

From the bulbs of the onion Allium cepa, a novel antifungal peptide distinct
from the antimicrobial peptide previously reported from onion seeds was
isolated. The antifungal peptide, designated allicepin, was purified with a
procedure that involved aqueous extraction, ion exchange chromatography on
DEAE/​cellulose, affinity chromatography on Affi/​gel blue gel and FPLC/​gel
filtration on Superdex 75. Allicepin was unadsorbed on DEAE/​cellulose and
adsorbed on Affi/​gel blue gel. The molecular weight of allicepin was estimated
to be 10 K by sodium dodecyl sulfate/​polyacrylamide gel electrophoresis and gel
filtration on Superdex 75. Allicepin exerted an inhibitory activity on mycelial
growth in several fungal species including Botrytis cinerea, Fusarium oxysporum,
Mycosphaerella arachidicola and Physalospora piricola.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15113089 [PubMed /​ indexed for MEDLINE]

151: Tsitol Genet. 2004 Jan/​Feb;38(1):55/​62.

[Number of aberrations per cell as a parameter of chromosome instability. 2.
Comparative analysis of the factors of different nature]

[Article in Ukrainian]

Kutsokon' NK, Lazarenko LM, Bezrukov VF, Rashydov NM, Grodzyns'kyi DM.

The average number of aberrations per aberrant cell was concluded to carry out
information on chromosome instability peculiarities induced by different
mutagens as it was shown in our previous work. The purpose of the current study
was to present comparative analysis of intercellular distribution of number of
aberrations and their theoretical approximations. Distribution of numbers of
aberrations per cell in Allium cepa L. and Allium fistulosum L. root tip cells
induced by different mutagenic factors (gamma/​irradiation, thiotepa,
formaldehyde and seed aging) have been studied. The results were approximated to
theoretical Poisson, geometric and negative binomial distributions. The
intercellular distribution of aberrations did not correspond to any of the used
theoretical distributions when A. cepa seeds were gamma/​irradiated. There was
some, but not regular, accordance with theoretical distributions when chemical
mutagens thiotepa in A. cepa and formaldehyde in A. fistulosum and seed aging in
both species were evaluated. During seed aging frequency of aberrant cells
increased more quickly in A. fistulosum in comparison with A. cepa.

Publication Types:
Comparative Study
English Abstract

PMID: 15098449 [PubMed /​ indexed for MEDLINE]

152: Plant Physiol. 2004 Apr;134(4):1793/​802. Epub 2004 Apr 2.

Evidence for symplastic involvement in the radial movement of calcium in onion
roots.

Cholewa E, Peterson CA.

Department of Biology, University of Waterloo, Waterloo, Ontario, Canada, N2L
G1.

The pathway of Ca(2+) movement from the soil solution into the stele of the root
is not known with certainty despite a considerable body of literature on the
subject. Does this ion cross an intact, mature exodermis and endodermis? If so,
is its movement through these layers primarily apoplastic or symplastic? These
questions were addressed using onion (Allium cepa) adventitious roots lacking
laterals. Radioactive Ca(2+) applied to the root tip was not transported to the
remainder of the plant, indicating that this ion cannot be supplied to the shoot
through this region where the exodermis and endodermis are immature. A more
mature zone, in which the endodermal Casparian band was present, delivered 2.67
nmol of Ca(2+) mm(/​1) treated root length d(/​1) to the transpiration stream,
demonstrating that the ion had moved through an intact endodermis. Farther from
the root tip, a third zone in which Casparian bands were present in the
exodermis as well as the endodermis delivered 0.87 nmol Ca(2+) mm(/​1) root
length d(/​1) to the transpiration stream, proving that the ion had moved through
an unbroken exodermis. Compartmental elution analyses indicated that Ca(2+) had
not diffused through the Casparian bands of the exodermis, and inhibitor studies
using La(3+) and vanadate (VO(4)(3/​)) pointed to a major involvement of the
symplast in the radial transport of Ca(2+) through the endodermis. It was
concluded that in onion roots, the radial movement of Ca(2+) through the
exodermis and endodermis is primarily symplastic.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 15064381 [PubMed /​ indexed for MEDLINE]

153: Ann Ig. 2003 Nov/​Dec;15(6):1077/​84.

[Genotoxic effects of pesticide/​treated vegetable extracts using the Allium cepa
chromosome aberration and micronucleus tests]

[Article in Italian]

Biscardi D, De Fusco R, Feretti D, Zerbini I, Izzo C, Esposito V, Nardi G,
Monarca S.

Dipartimento di Scienze della Vita, II Universita degli Studi di Napoli.

The presence of chemical residues in vegetables and fruit is a source of human
exposure to toxic and genotoxic chemicals. The mutagenic and carcinogenic action
of herbicides, insecticides and fungicides on experimental animals is already
known. Several studies have shown that chronic exposure to low levels of
pesticides can cause adverse health effects and that many pesticides are
mutagenic/carcinogenic. In the present research we monitored concurrently the
presence of pesticides and genotoxic compounds extracted from 21 treated
vegetables and 8 types of grapes sampled from the markets of a region in
Southern Italy. The extracts were analysed for pesticides by gas/​chromatography
and HPLC, and for genotoxicity with two plant tests in Allium cepa roots: the
micronucleus test and the chromosomal aberration test. We found 33 pesticides,
some of which are outlawed. Genotoxicity was found in some of the vegetables and
grapes tested. Allium cepa tests were sensitive for monitoring genotoxicity in
food extracts. The micronucleus test in interphase cells gave much higher
mutagenicity than the chromosomal aberration test in anaphase/​telophase cells.

Publication Types:
English Abstract

PMID: 15049565 [PubMed /​ indexed for MEDLINE]

154: Ann Ig. 2003 Nov/​Dec;15(6):959/​63.

[Evaluation of genotoxicity of sodium hypochlorite, chlorine dioxide and
peracetic acid using plant tests]

[Article in Italian]

Feretti D, Zani C, Alberti A, Copetta L, Nardi G, Monarca S.

Dipartimento di Medicina Sperimentale ed Applicata, Universita degli Studi di
Brescia.

The aim of this research was to evaluate the potential genotoxic effects of
three drinking water disinfectants by means of in vivo short/​term mutagenicity
tests using plants. The study was carried out in laboratory using distilled
water disinfected with sodium hypochlorite (NaClO), chlorine dioxide (ClO2) and
peracetic acid (PAA) at different concentrations both in neutral and acid
conditions. Untreated distilled water was used as a negative control.
Micronuclei test in Tradescantia pollen cells and chromosomal aberration test in
root cells of Allium cepa were the bioassays performed by exposing directly
plant bioindicators to treated and untreated distilled water. The
Tradescantia/micronuclei test gave positive results in most of the ClO2/​treated
water samples but only at acid pH. The Allium cepa test showed genotoxicity in
NaClO/​treated samples at acid pH and in a ClO2/​treated sample at pH 7.
PAA/​treated samples were always nongenotoxic. Since the concentrations tested of
free disinfectants are usually present in drinking water for biocidal purposes,
genotoxicity of these compounds could be a public health problem.

Publication Types:
English Abstract
Research Support, Non/​U.S. Gov't

PMID: 15049554 [PubMed /​ indexed for MEDLINE]

155: Ann Ig. 2003 Nov/​Dec;15(6):953/​7.

[Genotoxicity of surface water treated with different disinfectants using in
situ plant tests]

[Article in Italian]

Alberti A, Tizzoni M, Zani C, Feretti D, Gustavino B, Zerbini I, Nardi G,
Monarca S.

Dipartimento di Medicina Sperimentale ed Applicata, Universita degli Studi di
Brescia.

Disinfection of surface drinking water, in particular water chlorination,
produces many by/​products with genotoxic and/or carcinogenic activity. The aim
of this research was to evaluate the genotoxicity of surface water after
treatment with different disinfectants by means of in situ plant genotoxicity
assays. The study was carried out in a pilot plant using lake water after
sedimentation and filtration, which supplied four stainless steel basins: three
basins were disinfected with sodium hypochlorite, chlorine dioxide and peracetic
acid, respectively, and the fourth basin contained untreated lake water and was
used as a control. The study was carried out using water collected in different
seasons over a period of about one year in order to assess the treatments under
different physical and chemical lake water conditions. Plant genotoxicity tests
were performed by exposing plant bioindicators directly to raw and disinfected
water. The Tradescantia micronucleus test in pollen cells of the flowers of an
hybrid of Tradescantia and the Allium cepa test, a chromosome aberration test in
root cells of Allium cepa, showed genotoxic effects only in some disinfected
samples and revealed genotoxicity also in raw water in one experiment. The Vicia
faba test, a micronucleus test in root cells of Vicia faba, revealed
genotoxicity in many samples of disinfected water. The results of the study
indicated that the Vicia faba/MCN test was the most sensitive plant assay for
disinfected water, and that peracetic acid disinfection produced lower
genotoxicity than sodium hypochlorite or chlorine dioxide treatment.

Publication Types:
English Abstract
Research Support, Non/​U.S. Gov't

PMID: 15049553 [PubMed /​ indexed for MEDLINE]

156: Environ Mol Mutagen. 2004;43(2):137/​41.

Clastogenicity of atrazine assessed with the Allium cepa test.

Bolle P, Mastrangelo S, Tucci P, Evandri MG.

Department of Pharmacology of Natural Substances and General Physiology,
University of Rome La Sapienza, Rome, Italy.

Atrazine is classified as a restricted use pesticide and it is currently
included in an international revision program for re/​evaluating the human and
ecological (non/​human populations) health risks associated with its release into
the environment. The present study was undertaken to add new data on the
genotoxic potential of atrazine using the Allium cepa chromosome aberration
test. The test concentrations were based on the Maximum Contaminant Levels in
water intended for human consumption set by European and US regulations.
Atrazine produced a concentration/​related increase in the number of total
somatic chromosome aberrations, although this increase was statistically
significant (p<0.05) only at the highest test concentration (5 microg/L).
Analysis of the categories of structural chromosome damage indicated that breaks
were the predominant lesion induced; the percent of cells per bulb with breaks
also increased in a concentration/​related manner, and the increase was
statistically significant at the two highest test concentrations (1 and 5
microg/L) (p<0.05). The Allium cepa plant assay detected the clastogenicity of
atrazine at concentrations that are likely to be encountered in water, a common
site of atrazine contamination. Copyright 2004 Wiley/​Liss, Inc.

PMID: 14991755 [PubMed /​ indexed for MEDLINE]

157: Environ Res. 2004 Feb;94(2):221/​6.

Cytotoxicity and mode of action of maleic hydrazide in root tips of Allium cepa
L.

Marcano L, Carruyo I, Del Campo A, Montiel X.

Urbanizacion Monte Bello, AV 12 con calle Q No. 12/​21, Maracaibo, Estado Zulian,
Venezuela. letty@iamnet.com

Maleic hydrazide (MH) is an herbicide and is a regulator of the growth of buds
in vegetables during storage. It is used in agriculture/​in despite its known
effect as a mutagenic and clastogenic agent. In this research the effect of MH
on the root tips of Allium cepa L. was determined; correlations between the
effects of different concentrations and exposure times on the mitotic index (MI)
and induction of chromosomal aberrations (ChA) were also examined. Experiments
were carried out in triplicate, using aqueous solutions of MH to concentrations
of 10(/​6), 10(/​5), 10(/​4) and 10(/​3)M, at intervals of 0, 4, 8, 12, 24, and 48
h, with a control for each combination (with the MH substituted by distilled
water). The results revealed an inhibition of the MI linked to the concentration
and time of treatment (F=845.51, P<0.01 and F=427.58, P<0.01, respectively). For
all the concentrations used and exposure periods longer than 12 h, different
types of ChA were present, with significantly increased frequencies with
increases in the concentration and time of exposure (P<0.01). To determine the
mechanism through which the herbicide exerts its toxicity, ultrastructural
electron microscopy was conducted. The results reveal nucleolar alterations,
suggesting an inhibitory effect of biosynthetic activity.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 14757385 [PubMed /​ indexed for MEDLINE]

158: Br J Nutr. 2004 Feb;91(2):211/​8.

Consumption of brown onions (Allium cepa var. cavalier and var. destiny)
moderately modulates blood lipids, haematological and haemostatic variables in
healthy pigs.

Ostrowska E, Gabler NK, Sterling SJ, Tatham BG, Jones RB, Eagling DR, Jois M,
Dunshea FR.

Department of Primary Industries, Victorian Institute of Animal Science, 600
Sneydes Road, Werribee, Victoria 3030, Australia.

Although garlic and onions have long been associated with putative
cardiovascular health benefits, the effects of different commercially available
onions and level of intake have not been studied. Therefore, the aim of the
present study was to evaluate the potential health benefits of raw onions using
the pig as a biomedical model. Twenty/​five female (Large White x Landrace) pigs
were used in a (2 x 2)+1 factorial experiment. Pigs were fed a standard grower
diet supplemented with 100 g tallow/kg with the addition of Allium cepa var.
cavalier or var. destiny at 0, 10 or 25 g/MJ digestible energy for 6 weeks.
Overall, the consumption of onions resulted in significant reductions in plasma
triacylglycerol; however, the reductions were most pronounced in pigs fed
destiny onions (/​26 %, P=0.042). Total plasma cholesterol and LDL:HDL ratios
were not significantly different. Onion supplementation, regardless of the
variety, resulted in dose/​dependent reductions in erythrocyte counts and Hb
levels, while the white blood cell concentrations, particularly lymphocytes,
were increased in pigs that consumed onions. Furthermore, indices of blood
clotting were largely unaffected by onion consumption. In conclusion, dietary
supplementation with raw brown onions has moderate lipid/​modulating and
immunostimulatory properties. However, daily onion intake >25 g/MJ digestible
energy could be detrimental to erythrocyte numbers.

PMID: 14756906 [PubMed /​ indexed for MEDLINE]

159: Cell Biol Toxicol. 2003 Oct;19(5):299/​311.

Subcellular localization of chromium and nickel in root cells of Allium cepa by
EELS and ESI.

Liu D, Kottke I.

Department of Biology, College of Chemistry and Life Sciences, Tianjin Normal
University, Tianjin, PR China. donghua@mail.zlnet.com.cn

The ultrastructural investigation of the root cells of Allium cepa L. exposed to
two different concentrations of chromium + nickel (Cr+Ni) (10 micromol/L and 100
micromol/L) revealed that toxic symptoms were induced by increasing heavy metal
concentration and treatment time. Several significant ultrastructural changes
were caused by 100 micromol/L Cr+Ni /​ deposition of electron dense material in
cell walls; larger vacuolar precipitates surrounded by membranes inside
vacuoles; increment of disintegrated organelles and high vacuolization in
cytoplasm. The localization of the precipitates in which the metal ions were
detected by electron energy loss spectroscopy (EELS) and electron spectroscopic
imaging (ESI) was investigated. Chromium and nickel were localized in the
electron dense precipitates of the root cells exposed to only 100 micromol/L
Cr+Ni. None were found in the root cells exposed to 10 micromol/L Cr+Ni. Higher
amounts of Cr+Ni were mainly accumulated in the cell walls and vacuoles of the
fourth or fifth cortical layer.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 14703117 [PubMed /​ indexed for MEDLINE]

160: Phytochemistry. 2004 Jan;65(1):31/​41.

Bio/​fermentation of modified flavonoids: an example of in vivo diversification
of secondary metabolites.

Willits MG, Giovanni M, Prata RT, Kramer CM, De Luca V, Steffens JC, Graser G.

Syngenta Biotechnology, Inc., 3054 Cornwallis Road, Research Triangle Park, NC
27709, USA.

A bio/​fermentation technique was used for the in vivo diversification of
flavonoid structures based on expression in Escherichia coli of six
O/​methyltransferases (OMTs) from Mentha x piperita and one O/​glucosyltransferase
(GT) each from Arabidopsis thaliana and Allium cepa. Enzymes were shown to be
regio/​specific in in vitro experiments and modified a broad range of flavonoid
substrates at various positions. Using the flavonol quercetin as a model
substrate, we show that the product spectrum produced with the in vivo approach
is identical to that found in vitro. Additionally, using mixed cultures of E.
coli expressing different classes of modifying genes (OMTs and GTs), the
production of polymethylated flavonoid glucosides was observed. This report
demonstrates the potential to increase the structural diversity of plant
secondary metabolites using a multi/​enzyme, bio/​fermentation approach.

PMID: 14697269 [PubMed /​ indexed for MEDLINE]

161: J Environ Qual. 2003 Nov/​Dec;32(6):1965/​77.

Spatial variability of nitrous oxide emissions and their soil/​related
determining factors in an agricultural field.

Yanai J, Sawamoto T, Oe T, Kusa K, Yamakawa K, Sakamoto K, Naganawa T, Inubushi
K, Hatano R, Kosaki T.

Graduate School of Agriculture, Kyoto University, Kitashirakawa Oiwake, Sakyo,
Kyoto 606/​8502, Japan. yanai@kais.kyoto/​u.ac.jp

To evaluate spatial variability of nitrous oxide (N2O) emissions and to
elucidate their determining factors on a field/​scale basis, N2O fluxes and
various soil properties were evaluated in a 100/​ x 100/​m onion (Allium cepa L.)
field. Nitrous oxide fluxes were determined by a closed chamber method from the
one/​hundred 10/​ x 10/​m plots. Physical (e.g., bulk density and water content),
chemical (e.g., total N and pH), and biological (e.g., microbial biomass C and
N) properties were determined from surface soil samples (0/​0.1 m) of each plot.
Geostatistical analysis was performed to examine spatial variability of both N2O
fluxes and soil properties. Multivariate analysis was also conducted to
elucidate relationships between soil properties and observed fluxes. Nitrous
oxide fluxes were highly variable (average 331 microg N m(/​2) h(/​1), CV 217%)
and were log/​normally distributed. Log/​transformed N2O fluxes had moderate
spatial dependence with a range of >75 m. High N2O fluxes were observed at sites
with relatively low elevation. Multivariate analysis indicated that an organic
matter factor and a pH factor of the principal component analysis were the main
soil/​related determining factors of log/​transformed N2O fluxes. By combining
multivariate analysis with geostatistics, a map of predicted N2O fluxes closely
matched the spatial pattern of measured fluxes. The regression equation based on
the soil properties explained 56% of the spatially structured variation of the
log/​transformed N2O fluxes. Site/​specific management to regulate organic matter
content and water status of a soil could be a promising means of reducing N2O
emissions from agricultural fields.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 14674518 [PubMed /​ indexed for MEDLINE]

162: Genome. 2003 Dec;46(6):1098/​103.

Transmission of alien chromosomes from selfed progenies of a complete set of
Allium monosomic additions: the development of a reliable method for the
maintenance of a monosomic addition set.

Shigyo M, Wako T, Kojima A, Yamauchi N, Tashiro Y.

Department of Biological and Environmental Science, Faculty of Agriculture,
Yamaguchi University, Japan. shigyo@yamaguchi/​u.ac.jp

Selfed progeny of a complete set of Allium fistulosum /​ Allium cepa monosomic
addition lines (2n = 2x + 1 = 17, FF+1A/​FF+8A) were produced to examine the
transmission rates of respective alien chromosomes. All eight types of the
selfed monosomic additions set germinable seeds. The numbers of chromosomes (2n)
in the seedlings were 16, 17, or 18. The eight extra chromosomes varied in
transmission rate (%) from 9 (FF+2A) to 49 (FF+8A). The complete set of
monosomic additions was reproduced successfully by self/​pollination. A reliable
way to maintain a set of Allium monosomic additions was developed using a
combination of two crossing methods, selfing and female transmission. FF+8A
produced two seedlings with 18 chromosomes. Cytogenetical analyses, including
GISH, showed that the seedlings were disomic addition plants carrying two entire
homologous chromosomes from A. cepa in an integral diploid background of A.
fistulosum. Flow cytometry analysis showed that a double dose of the alien 8A
chromosome caused fluorescence intensity values spurring in DNA content, and
isozyme analysis showed increased glutamate dehydrogenase activity at the gene
locus Gdh/​1.

PMID: 14663528 [PubMed /​ indexed for MEDLINE]

163: J Econ Entomol. 2003 Oct;96(5):1510/​3.

Honey bee (Hymenoptera: Apidae) foraging in response to preconditioning with
onion flower scent compounds.

Silva EM, Dean BB, Hiller LK.

Department of Horticulture and Landscape Architecture, Washington State
University Irrigated Agriculture Research and Extension Center, 24106 North Bunn
Road, Prosser, WA 99350, USA. emsilva@wisc.edu

Onion (Allium cepa L.) seed production has long been plagued with yield problems
because of lack of pollination by the honey bee, Apis mellifera L. To attempt to
attract more pollinators to the onion seed production field, honey bees were
conditioned to associate onion floral odor components with a reward. Isolated
nucleus hives of honey bees were fed 30% sucrose solutions scented with a 0.2%
solution of onion floral odor compounds. After feeding on these solutions for 6
wk, bees were not found to prefer onion flowers to two competing food sources,
carrot and alfalfa flowers, at the 5% significance level. However, there was an
overall trend indicating a change in honey bee behavior, with fewer "trained"
bees visiting alfalfa and carrot and more visiting onion. Thus, it may be
possible to alter honey bee behavior with preconditioning but probably not to a
degree that would be economically significant.

Publication Types:
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 14650525 [PubMed /​ indexed for MEDLINE]

164: Biol Res. 2003;36(3/​4):381/​8.

p53/​independent checkpoint controls in a plant cell model.

Pelayo HR, Pincheira J, Gimenez/​Abian JF, Clarke DJ, de la Torre C.

Centro de Investigaciones Biologicas, CSIC, Ramiro de Maeztu, 9. E/​28040/​Madrid,
Spain.

Allium cepa L. meristems were used as a plant model to study the p53/​independent
control of S and G2 phases by checkpoint pathways, in eukaryotic cells.
Checkpoint blocks were induced at early and mid S by hydroxyurea. After their
spontaneous override, cells became accumulated in G2/​prophase, giving rise later
on to a delayed mitotic wave. Cell growth was maintained during the checkpoint
blocks, as the delayed mitoses were larger in size than the control ones. Under
continuous hydroxyurea treatment, the delayed mitotic was formed by two
subpopulations: normal mitoses corresponding to cells having properly recovered
from the checkpoint block, and abnormal ones resulting from checkpoint
adaptation. These latter cells displayed broken chromatids as they had unduly
overriden the G2 checkpoint block, without completing DNA repair. The frequency
of the checkpoint/​adapted mitoses increased with the hydroxyurea concentration
from 0.25 to 1.0 mM. However, from 1 mM hydroxyurea upwards, some of the cells
lost their competence for checkpoint adaptation. Therefore, the dose of a
genotoxic agent that still allows G2 checkpoint adaptation should always be
applied in order to get rid of uncontrolled proliferating cells. This is
specially suitable for cells lacking a functional p53 protein.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 14631870 [PubMed /​ indexed for MEDLINE]

165: Biol Cell. 2003 Nov;95(8):521/​6.

G2 checkpoint targets late replicating DNA.

Campo D, Samaniego R, Gimenez/​Abian JF, Gimenez/​Martin G, Lopez/​Saez JF, Diaz de
la Espina SM, De la Torre C.

Centro de Investigaciones Biologicas, CSIC. Velazquez, 144. E/​28006/​ Madrid,
Spain.

In the multinucleate cells induced in Allium cepa L. meristems, the nuclei
surrounded by the largest cytoplasm environment complete replication earlier
(advanced nuclei), but have a longer G2, than the others (delayed nuclei). Thus,
all nuclei break down the nuclear envelope and start metaphase simultaneously.
The present report shows that this synchronization relies on a checkpoint
mechanism. When completion of replication was prevented in the delayed nuclei
(due to in vivo 5/​aminouracil feeding initiated when the advanced nuclei were
already in G2), the metaphase was also further delayed in the advanced ones. In
turn, some of the delayed nuclei overrode the G2 checkpoint (adaptation) and
entered into mitosis with broken chromatids (Del Campo et al., 1997). Anoxic UVA
(313 nm) irradiation apparently prevents the binding of regulatory proteins to
Br/​DNA. The present report shows that late replicating sequences are the targets
of the checkpoint signal produced by the still replicating nuclei. This signal
delays metaphase in the advanced nuclei, whose DNA is already fully replicated.
Thus, when the already replicated sequences of late replicating DNA was modified
in the advanced nuclei by bromosubstitution followed by anoxic UVA irradiation,
they entered into mitosis without any delay, ignoring the inhibitory signals
produced by the still replicating nuclei.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 14630389 [PubMed /​ indexed for MEDLINE]

166: Phytochemistry. 2003 Dec;64(8):1381/​7.

Cinnamic acid amides from Chenopodium album: effects on seeds germination and
plant growth.

Cutillo F, D'Abrosca B, DellaGreca M, Di Marino C, Golino A, Previtera L,
Zarrelli A.

Dipartimento di Chimica Organica e Biochimica, Universita Federico II, Complesso
Universitario Monte Sant'Angelo, Via Cinthia 4, I/​80126, Naples, Italy.

Seven cinnamic acid amides have been isolated from Chenopodium album. The
structures have been attributed by means of their spectral data. One of them,
N/​trans/​4/​O/​methylferuloyl 4'/​O/​methyldopamine, is described for the first time.
Their effects on germination and growth of dicotyledons Lactuca sativa L.
(lettuce) and Lycopersicon esculentum L. (tomato) and of monocotyledon Allium
cepa L. (onion) as standard target species have been studied in the range
concentration 10(/​4)/​10(/​7) M.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 14630003 [PubMed /​ indexed for MEDLINE]

167: Phytochemistry. 2003 Dec;64(8):1367/​74.

Anthocyanins with 4'/​glucosidation from red onion, Allium cepa.

Fossen T, Slimestad R, Andersen M OM.

Department of Chemistry, University of Bergen, Allegt. 41, N/​5007, Bergen,
Norway.

The anthocyanins, cyanidin
3/​O/​(3"/​O/​beta/​glucopyranosyl/​6"/​O/​malonyl/​beta/​glucopyranoside)/​4'/​O/​beta/​gluco
pyranoside, cyanidin
7/​O/​(3"/​O/​beta/​glucopyranosyl/​6"/​O/​malonyl/​beta/​glucopyranoside)/​4'/​O/​beta/​gluco
pyranoside, cyanidin 3,4'/​di/​O/​beta/​glucopyranoside, cyanidin
4'/​O/​beta/​glucoside, peonidin
3/​O/​(6"/​O/​malonyl/​beta/​glucopyranoside)/​5/​O/​beta/​glucopyranoside and peonidin
3/​O/​(6"/​O/​malonyl/​beta/​glucopyranoside) have been isolated in minor amounts from
pigmented scales of red onion, Allium cepa, in addition to six known
anthocyanins. The structures were established mainly by extensive use of 2D NMR
spectroscopy and electrospray LC/​MS. With exception of cyanidin 4'/​glucoside and
cyanidin 3,4'/​diglucoside reported from Hibiscus esculentus with inadequate
documentation, this is the first identification of anthocyanins with
4'/​glycosidation. Compared to cyanidin 3/​glycosides the cyanidin 4'/​glucoside
derivatives showed hypsochromic shifts of visible lambda(max) and hyperchromic
effects on wavelengths around 440 nm, similar to pelargonidin 3/​glycosides.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 14630001 [PubMed /​ indexed for MEDLINE]

168: Toxicol In Vitro. 2003 Oct/​Dec;17(5/​6):525/​32.

Ecotoxicological evaluation of carbamazepine using six different model systems
with eighteen endpoints.

Jos A, Repetto G, Rios JC, Hazen MJ, Molero ML, del Peso A, Salguero M,
Fernandez/​Freire P, Perez/​Martin JM, Camean A.

National Institute of Toxicology, PO Box 863, 41080/​Sevilla, Spain.

The occurrence of pharmaceutically active compounds in the aquatic environment
has been recognized as one of the emerging issues in environmental chemistry.
However, the ecotoxicological effects of pharmaceuticals have still not been
researched adequately. Carbamazepine, an anticonvulsant commonly present in
surface and groundwater, was studied, using six ecotoxicological model systems
with eighteen endpoints evaluated at different exposure time periods. The
battery included the immobilization of Daphnia magna, bioluminescence inhibition
in the bacterium Vibrio fischeri, growth inhibition of the alga Chlorella
vulgaris, and micronuclei induction and root growth inhibition in the plant
Allium cepa. Cell morphology, neutral red uptake, total protein content, MTS
metabolization, lactate dehydrogenase leakage and activity and
glucose/​6/​phosphate dehydrogenase activity were studied in the salmonid fish
cell line RTG/​2. The total protein content, LDH activity, neutral red uptake and
MTT metabolization in Vero monkey kidney cells were also investigated. The most
sensitive system to carbamazepine was the Vero cell line, followed by Chlorella
vulgaris, Vibrio fischeri, Daphnia magna, Allium cepa, and RTG/​2 cells. EC50
values from 19 microM in Vero cells at 72 h to more than 1200 microM in other
systems, were obtained. Comparing the concentrations in water and the toxicity
quantified in our assay systems, carbamazepine is not expected to produce acute
toxic effects in the aquatic biota under these circumstances, but chronic and
synergistic effects with other chemicals cannot be excluded.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 14599440 [PubMed /​ indexed for MEDLINE]

169: Tsitol Genet. 2003 Jul/​Aug;37(4):20/​5.

[The number of aberrations in aberrant cells as a parameter of chromosomal
instability. 1. Characterization of dose dependency]

[Article in Ukrainian]

Kutsokon' NK, Bezrukov VF, Lazarenko LM, Rashydov NM, Hrodzyns'kyi DM.

Analysis of chromosome instability (CI) is of great importance in view of
pollution of the environment by genotoxic factors. Frequency of aberrant cells,
spectrum of chromosome aberrations, damages of aberrant cell and distribution of
aberrations in the cells are the most conventional parameters of CI. We have
carried out the comparative analysis of the frequency of aberrant cells and the
dynamics of aberrant cell damages induced by different mutagenic factors
(alpha/​irradiation from 241Am, gamma/​irradiation from 60Co and tioTEPA) in
Allium/​test. This comparative analysis denotes that the studied parameters have
different dynamics characterizing different mechanisms of CI in Allium cepa L.

Publication Types:
Comparative Study
English Abstract

PMID: 14569619 [PubMed /​ indexed for MEDLINE]

170: Phytochemistry. 2003 Nov;64(6):1069/​76.

Cloning and regiospecificity studies of two flavonoid glucosyltransferases from
Allium cepa.

Kramer CM, Prata RT, Willits MG, De Luca V, Steffens JC, Graser G.

Syngenta Biotechnology Incorporated, 3054 Cornwallis Road, Research Triangle
Park, NC 27709, USA.

Two UDP/​glucose/​dependent flavonoid glucosyltransferases (EC 2.4.1./​) isolated
from the epidermal layer of yellow onion (Allium cepa) were functionally
expressed in Escherichia coli and their substrate specificity investigated. The
two enzymes exhibited different substrate/​ and regio/​specificity profiles. A.
cepa UGT73G1 used a wide range of different flavonoid substrates including
flavonoids not naturally occurring in onion. Regiospecificity was indicated for
hydroxyl/​groups of the C/​3, C/​7 and C/​4' positions of the flavan backbone
structure to yield flavonoid mono/​ and diglucosides. In contrast, A. cepa
UGT73J1 showed activity only with the flavonoid mono/​glucoside isoquercitrin and
the isoflavone aglycone genistein, with regiospecificity for the C/​7 position.
The regiospecificity for both enzymes included positions that are glucosylated
in flavonoids of onion bulbs, indicating their involvement in flavonoid
biosynthesis in A. cepa.

PMID: 14568073 [PubMed /​ indexed for MEDLINE]

171: Ann Ig. 2003 Jul/​Aug;15(4):277/​302.

[Genotoxic and ecotoxic effects of urban waste water disinfected with sodium
hypochlorite or peracetic acid]

[Article in Italian]

Crebelli R, Conti L, Marchini S, Monarca S, Feretti D, Zerbini I, Zani C,
Veschetti E, Cutilli D, Ottaviani M.

Lab. di Tossicologia Comparata ed Ecotossicologia, 1st. Superiore di Sanita,
Roma.

Genotoxic and ecotoxicologic effects of urban wastewater disinfected with sodium
hypochlorite or peracetic acid were analyzed. The formation of genotoxic species
was studied by determining clastogenic and mutagenic activity of aqueous samples
and their extracts with in vivo and in vitro tests, respectively. In particular,
we have applied citogenetic tests to Allium cepa roots and Tradescantia
inflorescence (Allium cepa test and Tradescantia/micronuclei test) and reversion
test to Salmonella typhimurium according to the microsuspension procedure (Kado
test). The latter is the method of choice for the analysis of complex matrices
due to its high sensitivity and specificity. The mutagenic activity of
disinfected effluents was similar to the corresponding untreated wastewater both
sampled in four different periods. Therefore, the disinfection process did not
seem to contribute to aquatic mutagenicity in the examined range of biocide
concentration. The potential toxicity of disinfected wastewater for aquatic
organisms was evaluated using Daphnia magna. The acute toxicity of peracetic
acid in sewage was 0.4 mg/L (24 h E(L)C50). By comparing this value with
peracetic acid concentrations detected in effluents from a pilot plant it is
expected that treated wastewater would show acute toxic effects on aquatic
organisms. Dissociation compounds (hydrogen peroxide and acetic acid) and
possible by/​products of peracetic acid did not seem to contribute significantly
to the toxicity of sewage treated with peracetic acid.

Publication Types:
English Abstract
Research Support, Non/​U.S. Gov't

PMID: 14552196 [PubMed /​ indexed for MEDLINE]

172: J Agric Food Chem. 2003 Oct 8;51(21):6165/​72.

Lignans and neolignans from Brassica fruticulosa: effects on seed germination
and plant growth.

Cutillo F, D'Abrosca B, DellaGreca M, Fiorentino A, Zarrelli A.

Dipartimento di Chimica Organica e Biochimica, Universita Federico II, Complesso
Universitario Monte S. Angelo, Via Cinthia 4, I/​80126 Naples, Italy..

Five lignans, five neolignans, two sesquilignans, and a dilignan were identified
from a phytotoxic extract of Brassica fruticulosa L. Compounds 8, 9, 12, and 13
have been isolated for the first time. Structures were determined on the basis
of their spectroscopic features. Their effects on the germination and growth of
two dicotyledons, Lactuca sativa (lettuce) and Lycopersicon esculentum (tomato),
and a monocotyledon, Allium cepa (onion), as standard target species have been
studied.

PMID: 14518939 [PubMed /​ indexed for MEDLINE]

173: Cell Biol Int. 2003;27(10):837/​43.

Effect of caffeine on in vivo processing of alkylated bases in proliferating
plant cells.

Pincheira J, Lopez/​Saez JF, Carrera P, Navarrete MH, de la Torre C.

Programa de Genetica Humana, ICBM, Facultad de Medicina, Universidad de Chile,
Santiago, Chile.

DNA damage was induced by either 2 mM ethylmethanesulfonate or 1 Gy of
gamma/​irradiation in Allium cepa L. root meristems. The percentage of DNA that
migrated towards the anode during microelectrophoresis after alkali denaturation
(pH approximately 13.5) of the isolated nuclei (comet assay) reflects the amount
of single strand breaks present in them. There was some DNA migration
(12.8+//​2.4%) in untreated roots. This percentage doubled at the end of 1.5 h
treatment with the mono/​functional alkylating agent 2 mM ethylmethanesulfonate,
and trebled after a single exposure to 1 Gy of gamma/​rays. A proportion of the
DNA migration caused by these two treatments was reversed (repaired) by a 2 h
long period of in vivo recovery. However, when 5 mM caffeine was applied after
removal of the alkylating agent, the amount of DNA migrating to the comet tail
over the same 2 h period was almost double that at the onset of recovery. In
both control and irradiated nuclei, caffeine also increased the initial level of
DNA migration in the comet assay, but to a lesser extent. These results indicate
that caffeine increases the DNA damage that accumulates during the processing of
alkylated bases and, to a lesser extent, of the DNA bases damaged by
gamma/​irradiation. Thus, the potentiation effect of caffeine on induced
chromosomal damage may not just be due to caffeine/​induced cancellation of the
G2 checkpoint, but also to a direct effect this methylxantine has on the
processing of DNA damage.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 14499664 [PubMed /​ indexed for MEDLINE]

174: J Radiat Res (Tokyo). 2003 Jun;44(2):171/​7.

Energy/​dependent RBE of neutrons to induce micronuclei in root/​tip cells of
Allium cepa onion irradiated as dry dormant seeds and seedlings.

Zhang W, Fujikawa K, Endo S, Ishikawa M, Ohtaki M, Ikeda H, Hoshi M.

International Radiation Information Center, Research Institute for Radiation
Biology and Medicine, Hiroshima University, Hiroshima 734/​8553, Japan.

The relative biological effectiveness (RBE) of various energy neutrons produced
from a Schenkel/​type accelerator at the Research Institute for Radiation Biology
and Medicine, Hiroshima University (HIRRAC), compared with 60Co gamma/​ray
radiation was determined. The neutron radiations and gamma/​ray radiation
produced good linear changes in the frequency of micronuclei induced in the
root/​tip cells of Allium cepa onion irradiated as dry dormant seeds (seed assay)
and seedlings (seedling assay) with varying radiation doses. Therefore the RBE
for radiation/​induced micronuclei can be calculated as the ratio of the slopes
of the fitted linear dose response for the neutron radiations and the 60Co
gamma/​ray radiation. The RBE values by seed assay and seedling assay decreased
to 174 +//​ 7, from 216 +//​ 9, and to 31.4 +//​ 1.0, from 45.3 +//​ 1.3 (one
standard error), respectively, when neutron energies increased to 1.0 MeV, from
0.2 MeV, in the present study. Furthermore, the ratio of the micronucleus
induction rates of seed assay to seedling assay by gamma/​ray radiation was much
lower than that by neutron radiations.

PMID: 13678347 [PubMed /​ indexed for MEDLINE]

175: Plant Physiol. 2003 Oct;133(2):580/​8. Epub 2003 Aug 21.

An ATP/​binding cassette transporter GhWBC1 from elongating cotton fibers.

Zhu YQ, Xu KX, Luo B, Wang JW, Chen XY.

National Key Laboratory of Plant Molecular Genetics, Institute of Plant
Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese
Academy of Sciences, 300 Fenglin Road, Shanghai 200032, People's Republic of
China.

We have isolated a cDNA (GhWBC1) from cotton (Gossypium hirsutum) that encodes
an ATP/​binding cassette transporter of the WBC (white/brown complex) subfamily.
Members of this subfamily are half/​sized transporters and are reported to
mediate lipid and drug excretion in human (Homo sapiens). GhWBC1 is highly
expressed in developing fiber cells, but transcripts were also detectable in
other tissues except roots. The transcript level peaked in rapidly expanding
fibers from 5 to 9 DPA and then decreased. The GhWBC1 expression was weak in
fiber cells of an li (ligon/​lintless) mutant, which is defective in fiber cell
elongation. These data indicate that GhWBC1 gene expression correlates with
cotton fiber elongation. Transient expression of enhanced green fluorescence
protein/​GhWBC1 fusion protein in onion (Allium cepa) epidermal cells revealed
plasma membrane localization. The GhWBC1 cDNA driven by a constitutive 35S
promoter was introduced into Arabidopsis. About 13% of the transformants
produced short siliques (SSs), whereas others had normal siliques (long siliques
[LSs]). In siliques of SS lines, most embryos were severely shriveled, and only
several seeds per silique could be found at maturity. The transgene expression
level was higher in SS lines than in LS lines. Expression of AtWBC11, the
closest homolog of GhWBC1 in Arabidopsis, was not altered in either SS or LS
transgenic plants examined. These data suggest that GhWBC1 interferes with
substance translocation that is required for Arabidopsis seed and silique
development. Characterization of Arabidopsis WBC members, particularly AtWBC11,
will help to dissect the role of GhWBC1 in cotton fiber development and
elongation.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12972649 [PubMed /​ indexed for MEDLINE]

176: Biosci Biotechnol Biochem. 2003 Aug;67(8):1653/​9.

Purification, amino acid sequence, and cDNA cloning of trypsin inhibitors from
onion (Allium cepa L.) bulbs.

Deshimaru M, Watanabe A, Suematsu K, Hatano M, Terada S.

Department of Chemistry, Faculty of Science, Fukuoka University, 8/​19/​1
Nanakuma, Jonan/​ku, Fukuoka 814/​0180, Japan.

Three protease inhibitors (OTI/​1/​3) have been purified from onion (Allium cepa
L.) bulbs. Molecular masses of these inhibitors were found to be 7,370.2,
7,472.2, and 7,642.6 Da by matrix/​assisted laser desorption/ionization
time/​of/​flight mass spectrometry (MALDI/​TOF/​MS), respectively. Based on amino
acid composition and N/​terminal sequence, OTI/​1 and /​2 are the N/​terminal
truncated proteins of OTI/​3. All the inhibitors are stable to heat and extreme
pH. OTI/​3 inhibited trypsin, chymotrypsin, and plasmin with dissociation
constants of 1.3 x 10(/​9) M, 2.3 x 10(/​7) M, and 3.1 x 10(/​7) M, respectively.
The complete amino acid sequence of OTI/​3 showed a significant homology to
Bowman/​Birk family inhibitors, and the first reactive site (P1) was found to be
Arg17 by limited proteolysis by trypsin. The second reactive site (P1) was
estimated to be Leu46, that may inhibit chymotrypsin. OTI/​3 lacks an S/​S bond
near the second reactive site, resulting in a low affinity for the enzyme. The
sequence of OTI/​3 was also ascertained by the nucleotide sequence of a cDNA
clone encoding a 101/​residue precursor of the onion inhibitor.

PMID: 12951496 [PubMed /​ indexed for MEDLINE]

177: Tsitol Genet. 2003 May/​Jun;37(3):61/​6.

[Comparative evaluation of early and long/​term plant cell reactions under the
combination of short/​time and chronic impact of 232Th and Cd ]

[Article in Russian]

Evseeva TI, Geras'kin SA, Khramova ES.

The short/​time (30 hours) and chronic (30 days) 232Th and Cd combined effects on
Tradescantia and Allium cepa plants were investigated. The 232Th ion
concentration was equal to 0.18 mg/l and Cd ion/​/​to 60 mg/l. The early response
of both somatic and generative plant cells on Th and Cd combined action was
shown to appear in synergic increase of cytogenetic damage frequency. The level
of genotoxic and cytotoxic long/​term effects turned out to be lower than of the
additive one both under the chronic as under the short/​time action. These
similar in result responses occur on different biological organization levels:
in the case of short/​time action the effects observed are detected by the
intracellular compensatory processes, and in the case of chronic action by the
mass death of the most damaged buds in the inflorescence.

Publication Types:
Comparative Study
English Abstract

PMID: 12945185 [PubMed /​ indexed for MEDLINE]

178: Tsitol Genet. 2003 May/​Jun;37(3):30/​5.

[Role of active forms of oxygen in the induction of phytoalexin synthesis in
Allium cepa cells]

[Article in Ukrainian]

Kravchuk ZhM, Perkovs'ka HIu, Dmytriiev OP.

The results of studies on the role of plant superoxidesynthase signal system in
elicitation of antimicrobial phytoalexin (PA) synthesis in cultured Allium cepa
cells are presented. Exogenic application of O2/​ and H2O2 generators results in
formation of PA/​/​Tcibulins 1D and 2 [symbol: see text] in A. cepa cells. The
mechanism of PA elicitation does not require peroxidase activity. However, the
inhibition of one of the possible sources of the reactive oxygen, HADPH oxidase,
suppresses elicitor/​stimulated PA production. "Oxidative burst" modulation by
different chemical compounds in A. cepa cells results in changes of PA synthesis
elicitation. The results obtained suggest the tough correlation between
"oxidative burst" and elicitation of defense responses, PA synthesis in
particular.

Publication Types:
English Abstract

PMID: 12945180 [PubMed /​ indexed for MEDLINE]

179: Planta. 2003 Dec;218(2):204/​16. Epub 2003 Aug 21.

The association of peroxisomes with the developing cell plate in dividing onion
root cells depends on actin microfilaments and myosin.

Collings DA, Harper JD, Vaughn KC.

Plant Cell Biology Group, Research School of Biological Sciences, Australian
National University, GPO Box 475, ACT 2601 Canberra, Australia.
collings@rsbs.anu.edu.au

We have investigated changes in the distribution of peroxisomes through the cell
cycle in onion ( Allium cepa L.) root meristem cells with immunofluorescence and
electron microscopy, and in leek ( Allium porrum L.) epidermal cells with
immunofluorescence and peroxisomal/​targeted green fluorescent protein. During
interphase and mitosis, peroxisomes distribute randomly throughout the
cytoplasm, but beginning late in anaphase, they accumulate at the division
plane. Initially, peroxisomes occur within the microtubule phragmoplast in two
zones on either side of the developing cell plate. However, as the phragmoplast
expands outwards to form an annulus, peroxisomes redistribute into a ring
immediately inside the location of the microtubules. Peroxisome aggregation
depends on actin microfilaments and myosin. Peroxisomes first accumulate in the
division plane prior to the formation of the microtubule phragmoplast, and
throughout cytokinesis, always co/​localise with microfilaments.
Microfilament/​disrupting drugs (cytochalasin and latrunculin), and a putative
inhibitor of myosin (2,3/​butanedione monoxime), inhibit aggregation. We propose
that aggregated peroxisomes function in the formation of the cell plate, either
by regulating hydrogen peroxide production within the developing cell plate, or
by their involvement in recycling of excess membranes from secretory vesicles
via the beta/​oxidation pathway. Differences in aggregation, a phenomenon which
occurs in onion, some other monocots and to a lesser extent in tobacco BY/​2
suspension cells, but which is not obvious in the roots of Arabidopsis thaliana
(L.) Heynh., may reflect differences within the primary cell walls of these
plants.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12937986 [PubMed /​ indexed for MEDLINE]

180: Environ Mol Mutagen. 2003;42(2):85/​90.

In vitro assessment of mutagenicity and clastogenicity of BDE/​99, a
pentabrominated diphenyl ether flame retardant.

Evandri MG, Mastrangelo S, Costa LG, Bolle P.

Department of Pharmacology of Natural Substances and General Physiology,
University of Rome La Sapienza, Rome, Italy.

Polybrominated diphenyl ethers (PBDEs), which are widely used as flame
retardants, are considered persistent organic pollutants. To date, the available
toxicological data on PBDEs are limited and were primarily obtained by studying
technical blends. The present study was undertaken to investigate the
genotoxicity of the pure congener 2,2',4,4',5/​brominated diphenyl ether
(BDE/​99), one of the major isomers present in penta/​commercial products.
Bacterial reverse mutation assays in Salmonella typhimurium strains TA98 and
TA100 and in Escherichia coli WP2 uvrA, and the Allium cepa chromosome
aberration test were carried out to evaluate mutagenicity and clastogenicity.
The experimental design also involved testing a well/​known polychlorinated
biphenyl (PCB) mixture, Aroclor(R) 1254, which is structurally related to PBDEs.
BDE/​99 was negative in the bacterial mutagenicity assays, with and without S9
mix. Also, the frequency of structural chromosome aberrations was not
significantly higher than the control and no signs of cytotoxicity were observed
in BDE/​99/​treated A. cepa. Aroclor(R) 1254 was not mutagenic, but it induced a
significant increase in chromosomal aberrations in A. cepa. In conclusion,
BDE/​99 was not mutagenic in S. typhimurium or E. coli, or clastogenic in A.
cepa; however, the possibility that PBDEs might act through an epigenetic
mechanism cannot be excluded. Copyright 2003 Wiley/​Liss, Inc.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12929120 [PubMed /​ indexed for MEDLINE]

181: Plant Physiol. 2003 Aug;132(4):1989/​97.

Three nicotianamine synthase genes isolated from maize are differentially
regulated by iron nutritional status.

Mizuno D, Higuchi K, Sakamoto T, Nakanishi H, Mori S, Nishizawa NK.

Department of Applied Biological Chemistry, Graduate School of Agricultural and
Life Science, University of Tokyo, 1/​1/​1 Yayoi, Bunkyo/​ku, Tokyo 113/​8657,
Japan.

Nicotianamine synthase (NAS) is an enzyme that is critical for the biosynthesis
of the mugineic acid family of phytosiderophores in graminaceous plants, and for
the homeostasis of metal ions in nongraminaceous plants. We isolated one genomic
NAS clone, ZmNAS3, and two cDNA NAS clones, ZmNAS1 and ZmNAS2, from maize (Zea
mays cv Alice). In agreement with the increased secretion of phytosiderophores
with Fe deficiency, ZmNAS1 and ZmNAS2 were positively expressed only in
Fe/​deficient roots. In contrast, ZmNAS3 was expressed under Fe/​sufficient
conditions, and was negatively regulated by Fe deficiency. This is the first
report describing down/​regulation of NAS gene expression in response to Fe
deficiency in plants, shedding light on the role of nicotianamine in
graminaceous plants, other than as a precursor in phytosiderophore production.
ZmNAS1/​green fluorescent protein (sGFP) and ZmNAS2/​sGFP were localized at spots
in the cytoplasm of onion (Allium cepa) epidermal cells, whereas ZmNAS3/​sGFP was
distributed throughout the cytoplasm of these cells. ZmNAS1 and ZmNAS3 showed
NAS activity in vitro, whereas ZmNAS2 showed none. Due to its duplicated
structure, ZmNAS2 was much larger (65.8 kD) than ZmNAS1, ZmNAS3, and previously
characterized NAS proteins (30/​38 kD) from other plant species. We reveal that
maize has two types of NAS proteins based on their expression pattern and
subcellular localization.

PMID: 12913155 [PubMed /​ indexed for MEDLINE]

182: Plant Physiol. 2003 Jul;132(3):1475/​88.

Molecular and biochemical characterization of VR/​EILs encoding mung bean
ETHYLENE INSENSITIVE3/​LIKE proteins.

Lee JH, Kim WT.

Department of Biology, College of Science, Yonsei University, Seoul 120/​749,
Korea.

ETHYLENE INSENSITIVE3 (EIN3) is a transcription factor involved in the ethylene
signal transduction pathway in Arabidopsis. Two full/​length cDNA clones,
pVR/​EIL1 and pVR/​EIL2, encoding EIN3/​LIKE proteins were isolated by reverse
transcriptase/​polymerase chain reaction and by screening the cDNA library of
mung bean (Vigna radiata) hypocotyls. VR/​EIL1 and VR/​EIL2 share 70% identity and
display varying degrees of sequence conservation (39%/​65%) with previously
isolated EIN3 homologs from Arabidopsis, tobacco (Nicotiana tabacum) and tomato
(Lycopersicon esculentum) plants. Gel retardation assay revealed that both
VR/​EILs were able to interact specifically with optimal binding sequence/​1, the
recently identified optimal binding sequence for tobacco TEIL, with the binding
of VR/​EIL2 being more efficient than that of VR/​EIL1. Transient expression
analysis using a VR/​EIL::smGFP fusion gene in onion (Allium cepa) epidermal
cells indicated that the VR/​EIL proteins were effectively targeted to the
nucleus. The fusion protein of VR/​EIL2 with GAL4 DNA/​binding domain strongly
activated transcription of a reporter gene in yeast cells, and an essential
domain for transcription/​stimulating activity was localized to the
amino/​terminal acidic region that consists of 50 amino acid residues. In
contrast with what has been previously found in EIN3/​ and TEIL/​overexpressing
Arabidopsis plants, transgenic tobacco seedlings expressing the VR/​EIL genes
under the control of cauliflower mosaic virus 35S promoter did not exhibit a
constitutive triple response. Instead, they displayed a markedly enhanced
proliferation of root hairs, one of the typical ethylene response phenotypes,
and increased sensitivity to exogenous ethylene. In addition, the
pathogenesis/​related (PR) genes encoding beta/​1,3/​glucanase, osmotin, and PR1
were constitutively expressed in 35S::VR/​EIL lines without added ethylene, and
were hyperinduced in response to ethylene treatment. These results indicate that
VR/​EILs are functional in tobacco cells, thereby effectively transactivating the
GCC/​box/​containing PR genes and enhancing sensitivity to ethylene. The possible
physiological role of VR/​EILs is discussed in the light of the suggestion that
they are active components of the ethylene/​signaling pathway and their
heterologous expressions constitutively turn on a subset of ethylene responses
in tobacco plants.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12857828 [PubMed /​ indexed for MEDLINE]

183: Theor Appl Genet. 2003 Jun;107(1):162/​7. Epub 2003 Mar 14.

A PCR/​based marker system monitoring CMS/​(S), CMS/​(T) and (N)/​cytoplasm in the
onion ( Allium cepa L.).

Engelke T, Terefe D, Tatlioglu T.

Abteilung Angewandte Genetik, Universitat Hannover, Herrenhauser Strasse 2,
D/​30419 Hannover, Germany. thomas.engelke@genetik.uni/​hannover.de

The chimerical mitochondrial CMS(1)/​specific sequence in chives ( Allium
schoenoprasum) was used to develop a PCR/​marker that distinguishes both
male/​sterility inducing cytoplasms, CMS/​(S) and CMS/​(T), from the normal
cytoplasm in onion ( Allium cepa). In combination with a previously described
marker for CMS/​(S), which anchors in the upstream region of the mitochondrial
gene cob, all of the three known cytoplasms in the onion are distinguishable.
The PCR/​marker system was tested in 361 onion plants, which were selected from
F(1)/​hybrids and different open/​pollinated varieties. The latter are mainly
landraces from Turkey, in which all three cytoplasm types were detected.

PMID: 12835941 [PubMed /​ indexed for MEDLINE]

184: Mutat Res. 2003 Jul 8;538(1/​2):51/​61.

Persistence and prevention of aluminium/​ and paraquat/​induced adaptive response
to methyl mercuric chloride in plant cells in vivo.

Patra J, Sahoo MK, Panda BB.

Genecology and Tissue Culture Laboratory, Department of Botany, Berhampur
University, India.

Induction and persistence of adaptive response by aluminium (Al), 1 or 10
microM, and paraquat (PQ), 5 or 10 microM, against genotoxicity of methyl
mercuric chloride (MMCl), 1.26 microM, a standard environmental genotoxin, was
investigated in root meristem cells of Allium cepa. Subsequently, three
metabolic inhibitors, namely, 3/​aminobezamide (3/​AB, 10 or 100 microM), an
inhibitor of poly(ADP/​ribose) polymerase (PARP) implicated in DNA repair and/or
apoptosis, cycloheximide (CH, 0.1 or 1 microM), an inhibitor of protein
synthesis, and buthionine sulfoximine (BSO, 100 microM or 1mM), an inhibitor of
glutathione synthesis were tested for their ability to prevent the adaptive
response induced by conditioning doses of Al, 10 or 100 microM; and PQ, 5 or 100
microM, against MMCl/​challenge, 1.26 or 100 microM, in root meristems of A. cepa
or embryonic shoots of Hordeum vulgare, respectively. The findings demonstrated
that once triggered, the Al/​ or PQ/​adaptive response to MMCl could persist for
at least 48h in root meristems of A. cepa. Furthermore, the adaptive response
could effectively be prevented by 3/​AB, to a lesser degree by CH, and the least
by BSO, suggesting primarily the involvement of PARP and implicating DNA repair
in the underlying mechanisms of adaptive response in plant cells in vivo.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12834754 [PubMed /​ indexed for MEDLINE]

185: Theor Appl Genet. 2003 Aug;107(4):757/​67. Epub 2003 Jun 25.

The development and evaluation of consensus chloroplast primer pairs that
possess highly variable sequence regions in a diverse array of plant taxa.

Chung SM, Staub JE.

USDA/ARS, Vegetable Crops Unit, Department of Horticulture, 1575 Linden Drive,
University of Wisconsin, Madison, WI 53706 USA.

Although universal or consensus chloroplast primers are available, they are
limited by their number and genomic distribution. Therefore, a set of consensus
chloroplast primer pairs for simple sequence repeats (ccSSRs) analysis was
constructed from tobacco (Nicotiana tabacum L.) chloroplast sequences. These
were then tested for their general utility in the genetic analysis of a diverse
array of plant taxa. In order to increase the number of ccSSRs beyond that
previously reported, the target sequences for SSR motifs was set at A or T ( n
>/= 7) mononucleotide repeats. Each SSR sequence motif, along with +//​200/​bp
flanking sequences from the first of each mononucleotide base repeat, was
screened for homologies with chloroplast DNA sequences of other plant species in
GenBank databases using BLAST search procedures. Twenty three putative marker
loci that possessed conserved flanking sequence spans were selected for
consensus primer pair construction using commercially available computer
algorithms. All primer pairs produced amplicons after PCR employing genomic DNA
from members of the Cucurbitaceae (six species) and Solanaceae (four species).
Sixteen, 22 and 19 of the initial 23 primer pairs were successively amplified by
PCR using template DNA from species of the Apiaceae (two species), Brassicaceae
(one species) and Fabaceae (two species), respectively. Twenty of 23 primer
pairs were also functional in three monocot species of the Liliaceae [onion
(Allium cepa L.) and garlic (Allium sativum L.)], and the Poaceae [oat (Avena
sativa L.)]. Sequence analysis of selected ccSSR fragments suggests that ccSSR
length and sequence variation could be useful as a tool for investigating the
genetic relationships within a genus or closely related taxa (i.e., tribal
level). In order to provide for a marker system having significant coverage of
the cucumber chloroplast genome, ccSSR primers were strategically "recombined"
and named recombined consensus chloroplast primers (RCCP) for PCR analysis.
Successful amplification after extended/​length PCR of 16 RCCP primer pairs from
cucumber ( Cucumis sativus L.) DNA suggested that the amplicons detected are
representative of the cucumber chloroplast genome. These RCCP pairs, therefore,
could be useful as an initial molecular tool for investigation of traits related
to a chloroplast gene(s) in cucumber, and other closely related species.

Publication Types:
Evaluation Studies

PMID: 12827249 [PubMed /​ indexed for MEDLINE]

186: Ann Bot (Lond). 2003 Jul;92(1):21/​9.

Analysis of nuclear DNA content in Capsicum (Solanaceae) by flow cytometry and
Feulgen densitometry.

Moscone EA, Baranyi M, Ebert I, Greilhuber J, Ehrendorfer F, Hunziker AT.

Instituto Multidisciplinario de Biologia Vegetal (IMBIV), Casilla de Correo 495,
5000 Cordoba, Argentina. moscone@imbiv.unc.edu.ar

Flow cytometric measurements of nuclear DNA content were performed using
ethidium bromide as the DNA stain (internal standard, Hordeum vulgare 'Ditta',
1C = 5.063 pg) in 25 samples belonging to nine diploid species and four
varieties of Capsicum: C. chacoense, C. parvifolium, C. frutescens, C. chinense,
C. annuum var. annuum, C. baccatum var. baccatum, C. baccatum var. pendulum, C.
baccatum var. umbilicatum, C. eximium and C. pubescens, all with 2n = 24, and C.
campylopodium with 2n = 26. In addition, one sample each of C. annuum var.
annuum and C. pubescens were also analysed using Feulgen densitometry (standard,
Allium cepa 'Stuttgarter Riesen', 1C = 16.75 pg). Both staining methods resulted
in very similar relative values. Genome size displays significant variation
between but not within species (except in C. campylopodium), and contributes to
their taxonomic grouping. 1C/​values range from 3.34/​3.43 pg (3273/​3361 Mbp) in
C. chacoense and the C. annuum complex to 4.53/​5.77 pg (4439/​5655 Mbp) in C.
campylopodium and C. parvifolium. The data obtained support conclusions on
phylogenetic relationships in the genus derived from karyotype analyses using
chromosome banding approaches. In Capsicum, constitutive heterochromatin amount
is correlated with genome size, except in C. parvifolium, and is regarded as an
additive genomic component.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12824068 [PubMed /​ indexed for MEDLINE]

187: Environ Mol Mutagen. 2003;41(5):353/​9.

Genotoxicity of surface water treated with different disinfectants using in situ
plant tests.

Monarca S, Rizzoni M, Gustavino B, Zani C, Alberti A, Feretti D, Zerbini I.

Department of Hygiene and Public Health, University of Perugia, Italy.
monarca@unipg.it

Disinfection of surface drinking water, in particular water chlorination,
results in many by/​products with potential genotoxic and/or carcinogenic
activity. In the present study, we evaluated the genotoxicity of surface water
after treatment with different disinfectants by means of in situ plant
genotoxicity assays (micronucleus and chromosomal aberration tests) which can
detect both clastogenic and aneugenic effects. The study was carried out at a
pilot plant using lake water after sedimentation and filtration. This water
supplied four stainless steel basins: three basins were disinfected with sodium
hypochlorite, chlorine dioxide, and peracetic acid and the fourth basin
containing untreated lake water was used as a control. Plants were exposed in
situ in the basins. The study was carried out using water collected in different
seasons over a period of about 1 year in order to assess the treatments in
different physical and chemical lake water conditions. The micronucleus test in
root cells of Vicia faba (Vicia faba/MCN test) revealed genotoxicity in many
samples of disinfected water. The micronucleus test in Tradescantia pollen cells
and the chromosome aberration test in root cells of Allium cepa showed genotoxic
effects only in some disinfected samples, but also revealed genotoxicity in raw
water. The results of the study indicated that the Vicia faba/MCN test was the
most sensitive plant assay for disinfected water and that peracetic acid
disinfection produced similar or lower genotoxicity than sodium hypochlorite or
chlorine dioxide treatment. Copyright 2003 Wiley/​Liss, Inc.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12802806 [PubMed /​ indexed for MEDLINE]

188: Plant Cell Rep. 2003 Jun;21(9):905/​10. Epub 2003 Apr 3.

Chromosome doubling procedures of onion (Allium cepa L.) gynogenic embryos.

Jakse M, Havey MJ, Bohanec B.

Biotechnical Faculty, University of Ljubljana, Jamnikarjeva 101, 1000,
Ljubljana, Slovenia.

A novel approach for chromosome doubling that consists of treating embryos
instead of parts of micropropagated plants was investigated. Following 2/​year
trials, amiprofos/​methyl (APM) was found to be superior to oryzalin on the basis
of a lower toxicity, and we were able to narrow the range of concentrations of
APM. The addition of 2% dimethyl sulphoxide (DMSO) and 1% Triton X/​100 to 25
microM APM had no effect in all treatments. A final experiment with 6,658
embryos demonstrated that a 2/​day treatment in liquid media supplemented with 50
microM APM was the most successful with respect to chromosome doubling/​36.7% of
the plants were diploid/​but the survival rate was reduced to 52.5% of that of
the non/​treated control. A 2/​day treatment in liquid medium supplemented with 25
microM APM or a 2/​day treatment on solid medium with 50 microM APM resulted in
the production of diploids at a frequency of 28.9% and 21.3%, respectively.
These may represent alternative methods for chromosome doubling since compared
to the untreated control these two treatments reduced the survival rate by only
about 24%. Final ploidy and fertility of the large proportion of induced
mixoploid plants (up to 30.3%) need to be evaluated in further studies.

PMID: 12789509 [PubMed /​ indexed for MEDLINE]

189: Planta. 2003 Jun;217(2):283/​9. Epub 2003 Feb 11.

Atomic force microscopy of microfibrils in primary cell walls.

Davies LM, Harris PJ.

School of Biological Sciences, University of Auckland, Private Bag 92019,
Auckland, New Zealand.

Examination of angiosperm primary cell walls by transmission electron microscopy
shows that they contain microfibrils that probably consist of cellulose
microfibrils surrounded by associated non/​cellulosic polysaccharides. Previous
studies using solid/​state (13)C NMR spectroscopy have shown that the cellulose
is all crystalline with crystallites of cross/​sectional dimensions of 2/​3 nm.
However, it is not known if each microfibril contains only one, or more than one
crystallite because there is no agreement about the dimensions of the
microfibrils. Partially hydrated primary cell walls isolated from onion ( Allium
cepa L.) and Arabidopsis thaliana (L.) Heynh. were examined by atomic force
microscopy and the microfibril diameters determined. The cell walls of both
species contained tightly interwoven microfibrils of uniform diameter:
4.4+//​0.13 nm in the onion and 5.8+//​0.17 nm in A. thaliana. The effect was also
examined of extracting the A. thaliana cell walls to remove pectic
polysaccharides. The microfibrils in the extracted cell walls of A. thaliana
were significantly narrower (3.2+//​0.13 nm) than those in untreated walls. The
results are consistent with the microfibrils containing only one cellulose
crystallite.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12783336 [PubMed /​ indexed for MEDLINE]

190: Int J Food Sci Nutr. 2003 May;54(3):241/​6.

Hypoglycaemic and antioxidant effects of onion, Allium cepa: dietary onion
addition, antioxidant activity and hypoglycaemic effects on diabetic rats.

Campos KE, Diniz YS, Cataneo AC, Faine LA, Alves MJ, Novelli EL.

Department of Chemistry and Biochemistry, Institute of Biological Sciences,
University of Sao Paulo State, UNESP, Botucatu, Sao Paulo, Brazil.

The purpose of the present study was to discover the relative potency of onion,
Allium cepa, with respect to its hypoglycaemic and hypolipidaemic effects on the
diabetic situation, and the association of these effects with the potential
against oxidative stress. Male Wistar rats were divided into four groups. A
normal control (group A), and a non/​diabetic group (group B) were treated daily
with 1 ml A. cepa solution (0.4 g A. cepa/rat). Groups C and D were made
diabetic by an intraperitoneal injection of streptozotocin (STZ) (60 mg/kg body
weight) in citrate buffer (pH 6.3). These animals (groups C and D) were the STZ
diabetic control and STZ diabetic rats with onion intake, respectively. Onion
increased the fasting serum high/​density lipoprotein levels, and demonstrated
alleviation of hyperglycaemia in STZ diabetic rats. The hypoglycaemic and
hypolipidaemic actions of A. cepa were associated with antioxidant activity,
since onion decreased superoxide dismutase activities while no increased lipid
hydroperoxide and lipoperoxide concentrations were observed in diabetic rats
treated with A. cepa.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 12775373 [PubMed /​ indexed for MEDLINE]

191: Eur J Cancer Prev. 2003 Jun;12(3):195/​200.

Tomato and garlic can modulate azoxymethane/​induced colon carcinogenesis in
rats.

Sengupta A, Ghosh S, Das S.

Department of Cancer Chemoprevention, Chittaranjan National Cancer Institute 37,
Kolkata, India. archanadi1@rediffmail.com

Tomato (Lycopersicon esculentum) and garlic (Allium cepa) are important
constituents of the human diet. Compounds like diallyl sulfides, diallyl
disulfides and quercetin, which are active components of garlic, have known
anti/​inflammatory, antimutagenic activities. Similarly, active components in
tomato, such as kaempferol and chlorogenic acid, have antimutagenic activities
and lycopene is the most active oxygen quencher with potential chemopreventive
activities. In view of this, an endeavour was made to evaluate the
anticarcinogenic effect, if any, of tomato and garlic consumption individually
and in combination on azoxymethane/​induced colonic precancerous lesion, the
aberrant crypt foci in animal model. Sprague/​Dawley rats (4/​5 weeks old) were
injected with azoxymethane (15 mg/kg b.w.) and orally administered with 2% (w/v)
of tomato, garlic and a combination of both. After 12 weeks of first
azoxymethane injection, colons were assessed for aberrant crypt foci and
compared with the carcinogen control group. Lipid peroxidation level and
glutathione/​S/​transferase (GST) activity were assessed in liver as well as in
colon. Furthermore, in situ cell proliferation and apoptosis were estimated
using the Brdu incorporation method and TUNEL method respectively. It was
observed that aberrant crypt foci were reduced in all treated groups (by 32.11%
in garlic, by 76.14% in tomato and by 55.96% in the combination group). Among
treated groups, GST activity was found to be induced in both liver and colon,
whereas considerable reduction in lipid peroxidation level was observed in liver
as well as in colon with respect to the carcinogen control group. Significant
reduction in Brdu labelling index and increase in apoptotic index in colon was
noted in the treated groups. These results suggest that tomato and garlic
suspensions have a protective effect on colon carcinogenesis, which is mediated
by modulation of different biological pathways during carcinogenesis.

Publication Types:
Comparative Study

PMID: 12771557 [PubMed /​ indexed for MEDLINE]

192: Protoplasma. 2003 May;221(1/​2):57/​65.

Differential distribution of ascorbic acid, peroxidase activity, and hydrogen
peroxide along the root axis in Allium cepa L. and its possible relationship
with cell growth and differentiation.

Cordoba/​Pedregosa Mdel C, Cordoba F, Villalba JM, Gonzalez/​Reyes JA.

Departamento de Biologia Celular, Fisiologia e Inmunologia, Universidad de
Cordoba, Cordoba, Spain.

In this paper we show an asymmetrical distribution of apoplastic and symplastic
ascorbic acid content, peroxidase activities and hydrogen peroxide along the
root axis in Allium cepa L. For most of these metabolites, a marked gradient
from the root apex to the onion base was observed and was different for
apoplastic and symplastic compartments. In total homogenates, ascorbic acid
content was higher in the zones closer to the apex and decreased towards the
root base. However, an opposite pattern was observed in the apoplastic fraction.
Peroxidase activities with guaiacol, ferulic acid, ascorbic acid, and coniferyl
alcohol were also different depending on the evaluated zone and the fraction
used (apoplastic or symplastic). In general, each activity had a specific and
unique pattern. Immunodetection of peroxidase proteins in Western blots using
anti/​horseradish peroxidase and anti/​ascorbate peroxidase antibodies revealed
different bands at the different zones of the root. Hydrogen peroxide was
detected by electron microscopy and was mainly found in cell walls of epidermis
(or rhizodermis), meristem, and elongating cells. The number of cell walls
showing hydrogen peroxide decreased dramatically towards the root base. The
results suggest that the different zones of the root show specific requirements
for ascorbic acid and hydrogen peroxide. Also, each fragment of the root seems
to express specific peroxidase proteins. Different processes that take place at
every part of the root, as cell proliferation and elongation near the root apex
and gradual lignification and differentiation towards the root base are the key
to explain the results.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12768342 [PubMed /​ indexed for MEDLINE]

193: Ann Bot (Lond). 2003 Jul;92(1):73/​7. Epub 2003 May 21.

Fracture of plant tissues and walls as visualized by environmental scanning
electron microscopy.

Donald AM, Baker FS, Smith AC, Waldron KW.

Cambridge University, Cavendish Laboratory, Madingley Road, Cambridge CB3 0HE,
UK.

The environmental scanning electron microscope (ESEM) provides a highly relevant
and controllable environment in which to study hydrated systems without the
artefacts of other highly prepared specimens. The instrument facilitates control
of turgor through hydration using different chamber vapour pressures.
Deformation of a simple plant tissue/​upper epidermal layers in Allium cepa
(onion)/​was observed at the scale of the two principal failure mechanisms: cell
breakage; and cell separation induced by treatment with a chelating agent. Cell
rupture and release of contents occurred at cellular junctions ahead of an
imposed growing notch, indicating that disruption of cells occurred remotely
from the creation of a new surface. Cells that separated usually maintained
their turgor and the separation process took place through progressive failure
of middle lamellar material seen as strands between separating cells. These
mechanisms were compared with the rupture of excised Chara corallina walls that
occurred by formation and breakage of strands between separating wall layers.
This study provides in situ visual characterization of wall rupture and cell
separation at the microscopic level in hydrated plant material.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12763757 [PubMed /​ indexed for MEDLINE]

194: Plant Physiol. 2003 May;132(1):161/​73.

A novel family in Medicago truncatula consisting of more than 300
nodule/​specific genes coding for small, secreted polypeptides with conserved
cysteine motifs.

Mergaert P, Nikovics K, Kelemen Z, Maunoury N, Vaubert D, Kondorosi A, Kondorosi
E.

Institut des Sciences du Vegetal, Centre National de la Recherche Scientifique,
Avenue de la Terrasse, 91198 Gif/​sur/​Yvette, France.

Transcriptome analysis of Medicago truncatula nodules has led to the discovery
of a gene family named NCR (nodule/​specific cysteine rich) with more than 300
members. The encoded polypeptides were short (60/​90 amino acids), carried a
conserved signal peptide, and, except for a conserved cysteine motif, displayed
otherwise extensive sequence divergence. Family members were found in pea (Pisum
sativum), broad bean (Vicia faba), white clover (Trifolium repens), and Galega
orientalis but not in other plants, including other legumes, suggesting that the
family might be specific for galegoid legumes forming indeterminate nodules.
Gene expression of all family members was restricted to nodules except for two,
also expressed in mycorrhizal roots. NCR genes exhibited distinct temporal and
spatial expression patterns in nodules and, thus, were coupled to different
stages of development. The signal peptide targeted the polypeptides in the
secretory pathway, as shown by green fluorescent protein fusions expressed in
onion (Allium cepa) epidermal cells. Coregulation of certain NCR genes with
genes coding for a potentially secreted calmodulin/​like protein and for a signal
peptide peptidase suggests a concerted action in nodule development. Potential
functions of the NCR polypeptides in cell/​to/​cell signaling and creation of a
defense system are discussed.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12746522 [PubMed /​ indexed for MEDLINE]

195: Planta. 2003 May;217(1):21/​31. Epub 2003 Jan 25.

Sm and U2B" proteins redistribute to different nuclear domains in dormant and
proliferating onion cells.

Cui P, Moreno Diaz de la Espina S.

Nuclear Matrix Laboratory, Department of Plant Biology, Centro de
Investigaciones Biologicas, CSIC, Velazquez 144, 28006, Madrid, Spain.

Monoclonal antibodies against the spliceosomal proteins Sm and U2B", and against
p105, a protein component of interchromatin granules, were used to investigate
the nuclear distribution of the splicing factors in Allium cepa L. meristematic
cells. Confocal microscopy showed that in steady/​state proliferating cells, the
spliceosomal components were distributed into two nuclear domains: (i) a diffuse
nucleoplasmic network similar to that formed by interchromatin granules and (ii)
numerous Cajal bodies. These domains were the counterpart of the perichromatin
fibrils and granules, interchromatin granules and Cajal bodies observed by
electron microscopy after EDTA and bismuth oxynitrate stainings. Dormant cells
showed a nuclear distribution of the proteins in small Cajal bodies and numerous
micro/​speckles, correlated with the distribution of ribonucleoproteins (RNPs)
observed by electron microscopy. The spliceosomal proteins relocated to the
diffuse nucleoplasmic network and Cajal bodies when the cells were released from
dormancy by water soaking and they re/​started their proliferative activity.
Inhibition of RNA synthesis by 5,6/​dichloro/​1/​beta/​ d/​ribofuranosylbenzimidazole
(DRB) treatment in proliferating cells demonstrated that the micro/​speckles were
not the morphological expression of a transcription block. Fractionation and
confocal microscopy studies showed a differential association of the splicing
factors with the nuclear matrix depending not only on the protein, but also on
nuclear activity. Our results suggest a reversible relocation of the
spliceosomal proteins between different sub/​nuclear domains in physiological
conditions. We report here an unusual nuclear domain in dormant nuclei, the
micro/​speckles, corresponding to storage sites for RNPs, which were rapidly
mobilised after water imbibition.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12721845 [PubMed /​ indexed for MEDLINE]

196: Cell Biol Int. 2003;27(3):193/​5.

Heavy metals have a different action from aluminium in disrupting microtubules
in Allium cepa meristematic cells.

Dovgalyuk A, Kalynyak T, Blume YB.

Institute of Cell Biology and Genetic Engineering, Arcad Zabolotnogo str, 148,
03143, Kiev, Ukraine.

PMID: 12681305 [PubMed /​ indexed for MEDLINE]

197: J Radiat Res (Tokyo). 2002 Dec;43(4):397/​403.

Relative biological effectiveness of fission neutrons for producing micronuclei
in the root/​tip cells of onion seedlings after irradiation as dry seeds.

Zhang W, Endo S, Ishikawa M, Ikeda H, Hoshi M.

International Radiation Information Center, Research Institute for Radiation
Biology and Medicine, Hiroshima University, Hiroshima 734/​8553, Japan.

The relative biological effectiveness (RBE) of mixed neutron and gamma/​ray
radiation emitted at a 252Cf source at the Research Institute for Radiation
Biology and Medicine, Hiroshima University, compared with 60Co gamma/​ray
radiation was determined. The tissue/​absorbed dose contribution of the
accompanying gamma radiation was about 35.7% to the total tissue/​absorbed dose
from the 252Cf mixed radiation. The 252Cf mixed radiation and 60Co gamma rays
produced approximate linear changes in the frequency of micronuclei induced in
root/​tip cells of Allium cepa L. onion seedlings after irradiation as dry
dormant seeds with varying absorbed doses in onion seeds. Therefore, the RBE for
radiation/​induced micronuclei was calculated as the ratio of the slopes for the
252Cf mixed radiation and the 60Co gamma rays. The deduced RBE value of 252Cf
mixed radiation to 60Co gamma rays to induce micronuclei in dry dormant onion
seed cells was about 90.5 +//​ 3.6 (+//​ 1sigma); the RBE of neutrons from the
252Cf mixed radiation was about 150 +//​ 6 (+//​ 1sigma). Furthermore, the
sensitivity ratio of the induction rate of micronuclei in dry dormant seeds to
that in seedlings by neutrons from 252Cf mixed radiation was significantly
different from that by 60Co gamma rays. From these results, we concluded that
the repair efficiency of DNA damage induced by neutrons may be different from
that by gamma rays.

Publication Types:
Comparative Study

PMID: 12674204 [PubMed /​ indexed for MEDLINE]

198: Protoplasma. 2003 Mar;220(3/​4):219/​25.

On the mechanism of callose synthesis induction by metal ions in onion epidermal
cells.

Kartusch R.

Institute of Ecology and Conservation Biology, University of Vienna, Vienna,
Austria. robert.kartusch@univie.ac.at

Metal ions induce the synthesis of callose in Allium cepa epidermal cells.
Callose is deposited as single knoblike local accumulations, aggregates of
knobs, or furrowed clusters tightly attached to the cell wall. The most
effective metal is copper, it induces callose formation at micromolar
concentrations. Agents acting on inositolphosphate metabolism, phospholipase
inhibitors, calcium channel inhibitors, modulators of cytoplasmic calcium, or
receptor antagonists influence callose synthesis. It is concluded that metal
ions, especially Cu(2+), initiate a signal transduction chain by activation of
phospholipases and generation of inositol 1,4,5/​trisphosphate, and that callose
synthesis is a cellular defence reaction caused by the disturbance of
intracellular calcium homeostasis.

PMID: 12664286 [PubMed /​ indexed for MEDLINE]

199: Phytochemistry. 2003 Apr;62(8):1217/​20.

Anthocyanins from red onion, Allium cepa, with novel aglycone.

Fossen T, Andersen OM.

Department of Chemistry, University of Bergen, Allegt 41, N/​5007 Bergen, Norway.

Four anthocyanins with the same novel 4/​substituted aglycone,
carboxypyranocyanidin, have been isolated from acidified, methanolic extracts of
the edible scales as well as from the dry outer scales of red onion, Allium cepa
L. The structures of 1 and 2 were identified as the 3/​O/​beta/​glucopyranoside and
3/​O/​(6"/​O/​malonyl/​beta/​glucopyranoside) of 5/​carboxypyranocyanidin,
respectively. This aglycone,
5/​carboxy/​2/​(3,4/​dihydroxyphenyl)/​3,8/​dihydroxy/​pyrano[4,3,2/​de]/​1/​benzopyrylium
, is with exception of the substitution pattern on the phenyl ring similar to
carboxypyranomalvidin (vitisidin A) recently isolated from red wines. In
addition to 1 and 2, two analogues of 2 methylated at the terminal carboxyl
group of the acyl moiety (3) or at the aglycone carboxyl (4), respectively, were
also identified. These latter compounds are most probably formed by
esterification of 2 with the solvent (acidified methanol) during the isolation
process. The structures were elucidated by 2D NMR spectroscopy and LC/​MS.
Copyright 2003 Elsevier Science Ltd.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12648539 [PubMed /​ indexed for MEDLINE]

200: J Agric Food Chem. 2003 Mar 12;51(6):1586/​91.

Protein glycation inhibitory and antioxidative activities of some plant extracts
in vitro.

Kim HY, Kim K.

Food Function Research Division, Korea Food Research Institute, San 46/​1
Baekhyun/​dong, Bundang/​gu, Songnam/​si, Kyonggi/​do 463/​420, Republic of Korea.
khyey@kfri.re.kr

The protein glycation inhibitory activity of aqueous ethanolic extracts from 25
plant tissues was evaluated in vitro using the model system of bovine serum
albumin and fructose. The most bioactive plant tissue was Allium cepa (skin),
followed by Illicium religiosum (bark and wood), Fagopyrum esculentum (hull),
Origanum officinalis (leaf), Rosmarinus officinalis (leaf), Pyrus pyrifolia
(bark),Acanthopanax senticosus (bark), Eugenia caryophllata (leaf), and Erigeron
annuus (whole). The extracts with glycation inhibitory activity also showed
antioxidative activity when a micellar linoleic acid peroxidation system was
applied followed by 2,2'/​azinobis(3/​ethylbenzothiazoline/​6/​sulfonic acid)
radical cation decolorization and 1,1/​diphenyl/​2/​picrylhydrazyl free radical
scavenging assays. The glycation inhibitory activity was significantly
correlated with the antioxidative potency of the extracts. The positive
glycation inhibitory and antioxidative activities of these plants might suggest
a possible role in targeting aging and diabetic complications.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 12617589 [PubMed /​ indexed for MEDLINE]

201: Biochem Biophys Res Commun. 2003 Mar 7;302(2):397/​402.

Inhibition of peroxynitrite/​mediated cellular toxicity, tyrosine nitration, and
alpha1/​antiproteinase inactivation by 3/​mercapto/​2/​methylpentan/​1/​ol, a novel
compound isolated from Allium cepa.

Rose P, Widder S, Looft J, Pickenhagen W, Ong CN, Whiteman M.

Department of Community, Occupational and Family Medicine, Faculty of Medicine,
National University of Singapore, Singapore.

Peroxynitrite formation in vivo is implicated in numerous human diseases and
there is considerable interest in the use of antioxidants and natural products
such as thiols as "peroxynitrite scavengers". We therefore investigated the
effects of a recently identified constituent of onions,
3/​mercapto/​2/​methylpentan/​1/​ol (3/​MP), for its ability to inhibit
peroxynitrite/​mediated processes in vitro and using cultured human cells and
compared its effectiveness against glutathione. 3/​MP significantly inhibited
peroxynitrite/​mediated tyrosine nitration and inactivation of
alpha(1)/​antiproteinase to a greater extent than glutathione at each
concentration tested (15/​500 microM). 3/​MP also inhibited peroxynitrite/​induced
cytotoxicity, intracellular tyrosine nitration, and intracellular reactive
oxygen species generation in human HepG2 cells in culture to a greater extent
than glutathione. These data suggest that 3/​MP has the potential to act as an
inhibitor of ONOO(/​)/​mediated processes in vivo and that the antioxidant action
of 3/​MP deserves further study.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12604361 [PubMed /​ indexed for MEDLINE]

202: Indian J Exp Biol. 2002 Sep;40(9):1005/​9.

Antidiabetic and antioxidant effects of S/​methyl cysteine sulfoxide isolated
from onions (Allium cepa Linn) as compared to standard drugs in alloxan diabetic
rats.

Kumari K, Augusti KT.

Department of Biochemistry, University of Kerala, Kariavattom,
Thiruvananthapuram 695581, India.

Antidiabetic and antoxidant effects of S/​methyl cysteine sulfoxide (SMCS)
isolated from A. cepa and two standard drugs, glibenclamide and insulin were
studied and compared in alloxan diabetic rats after using each of them for
treatment for two months. These drugs ameliorated the diabetic condition
significantly, viz. maintenance of body weight and control of blood sugar in
rats. Further they lowered the levels of malondialdehyde, hydroperoxide and
conjugated dienes in tissues exhibiting antioxidant effect on lipid peroxidation
in experimental diabetes. This is achieved by their stimulating effects on
glucose utilization and the antioxidant enzymes, viz. superoxide dismutase and
catalase. The probable mechanism of action of SMCS and glibenclamide may be
partly dependent on the stimulation of insulin secretions and partly due to
their individual actions. In the amelioration of diabetes the standard drugs
showed a better action, but as an antioxidant SMCS proved to be a better one.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 12587728 [PubMed /​ indexed for MEDLINE]

203: Plant Physiol. 2003 Feb;131(2):697/​706.

Zonal changes in ascorbate and hydrogen peroxide contents, peroxidase, and
ascorbate/​related enzyme activities in onion roots.

Del Carmen Cordoba/​Pedregosa M, Cordoba F, Villalba JM, Gonzalez/​Reyes JA.

Departamento de Biologia Celular, Fisiologia e Inmunologia, University of
Cordoba, 14014 Cordoba, Spain.

Onion (Allium cepa) roots growing hydroponically show differential zonal values
for intra/​ (symplastic) and extra/​ (apoplastic) cellular ascorbate (ASC) and
dehydroascorbate (DHA) contents and for related enzyme activities. In whole
roots, ASC and DHA concentrations were higher in root apex and meristem and
gradually decreased toward the root base. Guaiacol peroxidase, ASC peroxidase,
monodehydroascorbate oxidoreductase, DHA reductase, catalase, and glutathione
reductase activities showed differential activity patterns depending on the zone
of the root and their apoplastic or symplastic origin. An in vivo staining of
peroxidase activity also revealed a specific distribution pattern along the root
axis. Using electron microscopy, hydrogen peroxide was found at different
locations depending on the root zone but was mainly located in cell walls from
epidermal and meristematic cells and in cells undergoing lignification. A
balanced control of all of these molecules seems to exist along the root axis
and may be directly related to the mechanisms in which the ASC system is
involved, as cell division and elongation. The role of ASC on growth and
development in relation to its presence at the different zones of the root is
discussed.

PMID: 12586893 [PubMed /​ indexed for MEDLINE]

204: Plant Physiol. 2003 Feb;131(2):454/​62.

Osmotic stress tolerance of transgenic tobacco expressing a gene encoding a
membrane/​located receptor/​like protein from tobacco plants.

Tamura T, Hara K, Yamaguchi Y, Koizumi N, Sano H.

Research and Education Center for Genetic Information, Nara Institute of Science
and Technology, Nara 630/​0192, Japan.

Tobacco (Nicotiana tabacum) genes regulated during the early stage of responses
to wounding were screened by a modified fluorescence differential display
method. Among 28 genes initially identified, a particular clone designated NtC7
was subjected to further analysis. Its transcripts were found to accumulate
rapidly and transiently within 1 h upon treatments with not only wounding but
also salt and osmotic stresses. However, jasmonic and abscisic acids and
ethylene did not effectively induce NtC7 transcripts. Amino acid sequence
analysis suggested NtC7 to be a new type of transmembrane protein that belongs
to the receptor/​like protein family, and a membrane location was confirmed in
onion (Allium cepa) epidermis cells transiently expressing an NtC7/​green
fluorescent protein fusion protein. Seeds of transgenic tobacco overexpressing
NtC7 normally germinated and grew in the presence of 500 mM mannitol, but not in
the presence of 220 mM sodium chloride or 60 mM lithium chloride. Cuttings of
mature transgenic leaf exhibited a marked tolerance upon treatment with 500 mM
mannitol for 12 h, at which concentration wild/​type counterparts were seriously
damaged. These results suggested that NtC7 predominantly functions in
maintenance of osmotic adjustment independently of ion homeostasis.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12586870 [PubMed /​ indexed for MEDLINE]

205: Theor Appl Genet. 2002 Aug;105(2/​3):173/​181. Epub 2002 Jun 11.

Transfer of a male/​sterility/​inducing cytoplasm from onion to leek ( Allium
ampeloprasum).

Peterka H, Budahn H, Schrader O, Havey J.

Federal Centre for Breeding Research on Cultivated Plants, Institute of
Horticultural Crops, Neuer Weg 22/23, 06484 Quedlinburg, Germany,
h.peterka@bafz.de

Two interspecific triploid (AAC) hybrids (84/1/​94 and 99/1/​94) from crosses
between onion [ Allium cepa (2 n=2 x=16, CC)] and leek [ A. ampeloprasum (2 n=4
x=32, AAAA)] were backcrossed to leek in order to transfer a
male/​sterility/​inducing cytoplasm from onion that would enable the production of
hybrid leek. GISH evaluations of meiosis in the interspecific hybrids revealed
irregularities due to univalent onion chromosomes producing micronuclei from
onion chromatin, whereas the pairing of the two sets of leek chromosomes was
nearly normal. Attempts to use colchicine to double the chromosome number of the
hybrids failed. Backcrosses of 84/1/​94 to leek as the pollen parent were not
successful. The first backcross of 99/1/​94 to tetraploid leek produced 11 BC(1)
plants with chromosome numbers between 38 and 41. Identification of parental
chromosomes by GISH showed that all eight onion chromosomes and 30/​33 leek
chromosomes were transmitted to the backcross progenies due to unreduced egg
cells. Onion chromosomes were eliminated during the second backcross. Southern
hybridization confirmed the transfer of the T/​cytoplasm like source of CMS from
onion to the BC(2) progenies. After the third backcross to leek, 158 plants were
obtained with varying numbers of onion chromosomes and some intergenomic
recombinant chromosomes. Alloplasmic leek plants without onion chromatin were
selected for further characterization of male sterility and quality traits.

PMID: 12582517 [PubMed /​ as supplied by publisher]

206: Theor Appl Genet. 2002 Aug;105(2/​3):167/​172. Epub 2002 Jun 21.

Evolution of 5S rDNA units and their chromosomal localization in Allium cepa and
Allium schoenoprasum revealed by microdissection and FISH.

Shibata F, Hizume M.

Biological Institute, Faculty of Science, Ehime University, Matsuyama 790/​8577,
Japan, shibatafukashi@hotmail.com

Allium cepa and Allium schoenoprasum each possess 5S rDNA units of two different
sizes. The evolution of the two repeat units and their chromosomal localization
were investigated. A. cepa has 5S rDNA loci in the proximal and distal regions
of the short arm of chromosome 7. When the proximal and distal segments of the
short arm of chromosome 7 were microdissected separately, and used as templates
for PCR, the short and long 5S rDNA fragments were amplified predominantly from
the proximal and distal segments, respectively. The nucleotide sequence of the
long 5S rDNA unit resulted from partial duplication of a non/​transcribed spacer
(NTS) and the insertion of a unique sequence. FISH using a probe consisting of
the unique sequence demonstrated that the long unit was distally localized. In
A. cepa, the long 5S rDNA unit is only present distally and the short unit is
predominantly located proximally on the short arm of chromosome 7. In A.
schoenoprasum, the NTSs of the two different/​sized 5S rDNAs had quite different
sequences. The two 5S rDNA loci were localized very close together in the
interstitial region of chromosome 6. FISH, using long and short 5S rDNA unit
probes with a competitor of a 120/​bp sequence of the 5S rRNA gene, indicated
that the long 5S rDNA unit was localized proximally and the short unit distally.
Although the NTSs of the 5S rDNA of A. cepa and A. schoenoprasum had quite
different nucleotide sequences, the long 5S rDNA units of A. cepa and A.
schoenoprasum share a common 75/​bp sequence. This sequence might act in the
formation of the long 5S rDNA unit in Allium species.

PMID: 12582516 [PubMed /​ as supplied by publisher]

207: Shi Yan Sheng Wu Xue Bao. 1999 Jun;32(2):185/​95.

[Localization with BrUTP labeling technique of RNA polymerase II transcription
in meristematic cells of Allium cepa]

[Article in Chinese]

Hu B, Xing M.

Institute of Genetics and Cytology, Northeast Normal University, Changchun
130024.

The technique of pulse/​labeling of cells with 5/​bromouridine/​5'/​triphosphate
(BrUTP) and immunological detection of the incorporated BrUTP is a
newly/​developed experimental approach to localize nascent RNA polymerase II
transcripts in the nucleus. This technique has been widely used since it was
first reported in 1993, but most of the studies were carried out with
fluorescence microscopy and animal cells, we are still limited in the knowledge
about ultrastructural localization of RP II transcripts in the nucleus of
eukaryotes, especially in that of plant cells. Attempts have been made in this
paper to localize nascent RP II transcripts in the nucleus of meristematic cells
of Allium cepa with the technique of pulse/​labeling of BrUTP and immunoelectron
microscopy. After labeling with BrUTP and detection with anti/​BrdU antibody, a
large number of gold particles representing RP II transcripts were observed in
the periphery of chromatin domains, the gold particles in the periphery
accounted for 92.70% of the total gold particles in the extranucleolar regions,
and the gold density of the periphery was 75.42/micron 2, much higher than that
of the center of the chromatin domains and the interchromatin domains which were
only 5.89/micron 2 and 2.00/micron 2 respectively, indicating that RP II
transcripts were being actively synthesized in the periphery of the chromatin
domains. When the specimens were treated with alpha/​amanitin which can
specifically inhibits the activity of RP II, gold particles in the
extranucleolar regions of the specimens were decreased dramatically and the gold
density of the regions dropped strikingly from 44.60/micron 2 to 2.67/micron 2,
confirming that the gold particles in the regions represent RP II transcripts.
The distribution of nascent RP II transcripts in the nucleus of the intact plant
cells is discussed.

Publication Types:
English Abstract

PMID: 12548785 [PubMed /​ indexed for MEDLINE]

208: Arch Virol. 2002 Dec;147(12):2349/​63.

Subcellular targeting domains of Abutilon mosaic geminivirus movement protein
BC1.

Zhang SC, Ghosh R, Jeske H.

Department of Molecular Biology and Plant Virology, Institute of Biology,
University of Stuttgart, Stuttgart, Germany.

Abutilon mosaic geminivirus (AbMV) encodes two movement proteins, BV1 and BC1,
which mediate the intra/​ and intercellular transport of viral DNA in plants
cooperatively. It has been shown previously that singly expressed BC1, fused to
green fluorescent protein (GFP), accumulates preferentially either at the cell
periphery or around the nucleus in separate plant cells. To define the BC1
domains responsible for understanding the subcellular sorting, deletion mutants
were fused to GFP and expressed transiently in epidermal cells of non/​host
(Allium cepa) as well as of host (Nicotiana benthamiana) plants with basically
the same results in both species. BC1/​mediated intracellular sorting was
dependent on two protein domains, an "anchor domain" (amino acids 117 to 180)
which is necessary and sufficient to fix GFP:BC1 at the cell periphery and the
nuclear environment, and a "pilot domain" (amino acids 1 to 49) in the absence
of which the fusion proteins were found at both sites in the same cell
simultaneously.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 12491102 [PubMed /​ indexed for MEDLINE]

209: Plant Physiol. 2002 Nov;130(3):1172/​80.

A novel nucleus/​targeted protein is expressed in barley leaves during senescence
and pathogen infection.

Krupinska K, Haussuhl K, Schafer A, van der Kooij TA, Leckband G, Lorz H, Falk
J.

Institute of Botany, University of Kiel, Olshausenstrasse 40, D/​24098 Kiel,
Germany. kkrupinska@bot.uni/​kiel.de

The barley (Hordeum vulgare) cDNA HvS40 represents a gene with enhanced mRNA
level during leaf senescence. Biolistic transformation of onion (Allium cepa)
epidermal cell layers with a glucuronidase fusion protein construct provided
evidence that the 15.4/​kD protein encoded by HvS40 is localized to the nucleus.
Expression of the gene is induced by jasmonate and salicylic acid; both are
known to act as signaling compounds during senescence and defense toward
pathogens. Transcript levels of HvS40 were observed to be particularly high in
leaf sectors that undergo necrosis and chlorosis after infection with
Pyrenophora teres. This pathogen/​related expression is, in contrast, clearly
reduced in transgenic barley plants expressing a stilbene synthase from grape
(Vitis vinifera), whereas the mRNA level of a gene encoding the pathogen/​related
protein HvPR1 is unaffected. In situ hybridization with HvS40 antisense RNA
revealed that during leaf senescence, the HvS40 transcript predominantly
accumulates in the mesophyll. Taken together, the findings suggest a connection
between the nuclear protein encoded by HvS40 and the degeneration of
chloroplasts occurring during senescence and during infection of barley
wild/​type plants with P. teres.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12427984 [PubMed /​ indexed for MEDLINE]

210: Protoplasma. 2002 Oct;220(1/​2):69/​78.

Differential localisation of GFP fusions to cytoskeleton/​binding proteins in
animal, plant, and yeast cells. Green/​fluorescent protein.

Timmers AC, Niebel A, Balague C, Dagkesamanskaya A.

Laboratoire de Biologie Moleculaire des Relations Plantes/​Microorganismes, Unite
Mixte de Recherche du Centre National de la Recherche Scientifique, Institut
National de la Recherche Agronomique, Castanet/​Tolosan. timmers@uni/​bonn.de

The structure and functioning of the cytoskeleton is controlled and regulated by
cytoskeleton/​associated proteins. Fused to the green/​fluorescent protein (GFP),
these proteins can be used as tools to monitor changes in the organisation of
the cytoskeleton in living cells and tissues in different organisms. Since the
localisation of a specific cytoskeleton protein may indicate a particular
function for the associated cytoskeletal element, studies of
cytoskeleton/​binding proteins fused to GFP may provide insight into the
organisation and functioning of the cytoskeleton. In this article, we focused on
two animal proteins, human T/​plastin and bovine tau, and studied the
distribution of their respective GFP fusions in animal COS cells, plant
epidermal cells (Allium cepa), and yeast cells (Saccharomyces cerevisiae).
Plastin/​GFP localised preferentially to membrane ruffles, lamellipodia and focal
adhesion points in COS cells, to the actin filament cytoskeleton within
cytoplasmic strands in onion epidermal cells, and to cortical actin patches in
yeast cells. Thus, in these 3 very different types of cells plastin/​GFP
associated with mobile structures in which there are high rates of actin
turnover. Chemical fixation was found to drastically alter the distribution of
plastin/​GFP. Tau/​GFP bound to microtubules in COS cells and onion epidermal
cells but failed to bind to yeast microtubules. Thus, animal and plant
microtubules appear to have a common tau binding site which is absent in yeast.
We conclude that the study of the distribution patterns of microtubule/​ and
actin/​filament/​binding proteins fused to GFP in heterologous systems should be a
valuable tool in furthering our knowledge about cytoskeleton function in
eukaryotic cells.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12417938 [PubMed /​ indexed for MEDLINE]

211: Phytother Res. 2002 Nov;16(7):603/​15.

Onions/​/​a global benefit to health.

Griffiths G, Trueman L, Crowther T, Thomas B, Smith B.

Department of Plant Genetics and Biotechnology, Horticulture Research
International, Wellesbourne CV35 9EF, UK. gareth.griffiths@hri.ac.uk

Onion (Allium cepa L.) is botanically included in the Liliaceae and species are
found across a wide range of latitudes and altitudes in Europe, Asia, N. America
and Africa. World onion production has increased by at least 25% over the past
10 years with current production being around 44 million tonnes making it the
second most important horticultural crop after tomatoes. Because of their
storage characteristics and durability for shipping, onions have always been
traded more widely than most vegetables. Onions are versatile and are often used
as an ingredient in many dishes and are accepted by almost all traditions and
cultures. Onion consumption is increasing significantly, particularly in the USA
and this is partly because of heavy promotion that links flavour and health.
Onions are rich in two chemical groups that have perceived benefits to human
health. These are the flavonoids and the alk(en)yl cysteine sulphoxides (ACSOs).
Two flavonoid subgroups are found in onion, the anthocyanins, which impart a
red/purple colour to some varieties and flavanols such as quercetin and its
derivatives responsible for the yellow and brown skins of many other varieties.
The ACSOs are the flavour precursors, which, when cleaved by the enzyme
alliinase, generate the characteristic odour and taste of onion. The downstream
products are a complex mixture of compounds which include thiosulphinates,
thiosulphonates, mono/​, di/​ and tri/​sulphides. Compounds from onion have been
reported to have a range of health benefits which include anticarcinogenic
properties, antiplatelet activity, antithrombotic activity, antiasthmatic and
antibiotic effects. Here we review the agronomy of the onion crop, the
biochemistry of the health compounds and report on recent clinical data obtained
using extracts from this species. Where appropriate we have compared the data
with that obtained from garlic (Allium sativum L.) for which more information is
widely available. Copyright 2002 John Wiley & Sons, Ltd.

Publication Types:
Research Support, Non/​U.S. Gov't
Review

PMID: 12410539 [PubMed /​ indexed for MEDLINE]

212: Chromosoma. 2002 Sep;111(3):184/​91. Epub 2002 Jun 14.

The identification and analysis of the sequences that allow the detection of
Allium cepa chromosomes by GISH in the allodiploid A. wakegi.

Shibata F, Hizume M.

Biological Institute, Faculty of Science, Ehime University, Matsuyama 790/​8577,
Japan. shibatafukashi@hotmail.com

In Allium wakegi, which is an allodiploid species between Allium cepa and Allium
fistulosum, each genome can be clearly distinguished using genomic in situ
hybridization (GISH). Genomic DNA of A. cepa and A. fistulosum is differentiated
both qualitatively and quantitatively. We wanted to isolate nucleotide sequences
that give genome/​specific signals on A. cepa chromosomes in GISH experiments in
A. wakegi. We isolated 23 clones that show GISH/​like signal patterns in
fluorescence in situ hybridization (FISH) and analyzed their distribution in the
A. cepa/​ and A. fistulosum/​derived genomes of A. wakegi. There was considerable
variation in the abundance and distribution of these cloned sequences on the
chromosomes of the two species. The degree of A. cepa specificity varied among
the clones. Twenty/​two of the clones showed an even distribution over most
chromosome arms with some clustering in the pericentromeric regions, but one
clone showed very distinct terminal signals on some chromosomes. Whereas these
sequences are not specific for A. cepa, changes in bases in nucleotide sequences
and in their amount result in genome/​specific characteristics in GISH
experiments.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12355208 [PubMed /​ indexed for MEDLINE]

213: Biotech Histochem. 2002 May;77(3):145/​52.

Determination of the fraction of S/​phase cells in root meristems using
bromodeoxyuridine labeling.

Hervas JP, de la Flor J, Santa/​Cruz MC.

Department of Cell Biology, Faculty of Sciences, Autonomous University of
Barcelona, Bellaterra, Spain.

The use of bromodeoxyuridine (BrdU) and subsequent immunocytochemical
visualization for studying cell proliferation in plant meristems was
investigated in Allium cepa L. root/​tips. We describe the optimization of an
indirect immunoperoxidase method for detecting incorporation of this DNA
precursor in pulse/​labeled cells. The basic object of this study is to quantify
the extent to which the fraction of S/​phase cells can reliably be estimated in
asynchronous populations. A matrix of parallel labeling schedules with
tritiated/​thymidine or BrdU was developed, and the labeling indices provided by
autoradiography or immunocytochemistry were compared. Thus, 0.5 mM BrdU assured
saturation S/​phase labeling after an exposure time of 30 min, and the mean
length of the S/​phase determined under such conditions was similar to that
previously reported for this plant system. Interestingly, Feulgen staining did
not interfere with subsequent detection of the BrdU probe. This allowed
comparative evaluations of the nuclear DNA content by Feulgen/​microdensitometry
and the position of a given cell in G1, S or G2 compartments. We also explored
the possibility of quantifying BrdU/​incorporation in single nuclei by
densitometry measurement of the peroxidase label.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12229935 [PubMed /​ indexed for MEDLINE]

214: J Electron Microsc (Tokyo). 2002;51(4):231/​9.

Combination of electron microscopic in situ hybridization and anti/​DNA antibody
labelling reveals a peculiar arrangement of ribosomal DNA in the fibrillar
centres of the plant cell nucleolus.

Yano H, Sato S.

Department of Biology and Earth Sciences, Faculty of Science, Ehime University,
Matsuyama, Japan.

The fibrillar centres (FCs) in the nucleoli of Allium cepa usually contained
compact dense chromatin, which was always surrounded with light fibrous material
(LFM). Distribution of 18S ribosomal DNA (rDNA) in the FCs was examined by in
situ hybridization at the light and electron microscopic levels and the results
were compared with those obtained by immunogold labelling with anti/​DNA
antibodies. Anti/​DNA antibodies heavily labelled the dense chromatin of the FCs
but scarcely labelled the LFM. However, electron microscopic in situ
hybridization using the 18S rDNA probe showed that the label in the dense
chromatin was extremely weak compared with that obtained by the anti/​DNA
antibody labelling: the specific label with anti/​DNA antibodies of the dense
chromatin was about 15 times as much as that of the LFM, whereas the specific
label with in situ hybridization in the dense chromatin was only about 1.7 times
higher than in the LFM. These results suggest that the rDNA encoding rRNA is
preferentially released from the dense chromatin and that non/​transcribed
intergenic spacers remain in the dense chromatin as the anchoring sites of rDNA.

PMID: 12227553 [PubMed /​ indexed for MEDLINE]

215: Plant Physiol. 1997 Oct;115(2):593/​598.

Molecular Rigidity in Dry and Hydrated Onion Cell Walls.

Ha MA, Apperley DC, Jarvis MC.

Chemistry Department, Glasgow University, Glasgow G12 8QQ, Scotland, United
Kingdom (M./​A.H., M.C.J.).

Solid/​state nuclear magnetic resonance relaxation experiments can provide
information on the rigidity of individual molecules within a complex structure
such as a cell wall, and thus show how each polymer can potentially contribute
to the rigidity of the whole structure. We measured the proton magnetic
relaxation parameters T2 (spin/​spin) and T1p (spin/​lattice) through the
13C/​nuclear magnetic resonance spectra of dry and hydrated cell walls from onion
(Allium cepa L.) bulbs. Dry cell walls behaved as rigid solids. The form of
their T2 decay curves varied on a continuum between Gaussian, as in crystalline
solids, and exponential, as in more mobile materials. The degree of molecular
mobility that could be inferred from the T2 and T1p decay patterns was
consistent with a crystalline state for cellulose and a glassy state for dry
pectins. The theory of composite materials may be applied to explain the
rigidity of dry onion cell walls in terms of their components. Hydration made
little difference to the rigidity of cellulose and most of the xyloglucan shared
this rigidity, but the pectic fraction became much more mobile. Therefore, the
cellulose/xyloglucan microfibrils behaved as solid rods, and the most
significant physical distinction within the hydrated cell wall was between the
microfibrils and the predominantly pectic matrix. A minor xyloglucan fraction
was much more mobile than the microfibrils and probably corresponded to
cross/​links between them. Away from the microfibrils, pectins expanded upon
hydration into a nonhomogeneous, but much softer, almost/​liquid gel. These data
are consistent with a model for the stress/​bearing hydrated cell wall in which
pectins provide limited stiffness across the thickness of the wall, whereas the
cross/​linked microfibril network provides much greater rigidity in other
directions.

PMID: 12223827 [PubMed /​ as supplied by publisher]

216: Arch Environ Contam Toxicol. 2002 Oct;43(3):284/​91.

Cytogenetic damage in shallot ( Allium cepa) root meristems induced by oil
industry "high/​density brines".

Vidakovic/​Cifrek Z, Pavlica M, Regula I, Papes D.

Department of Biology, Faculty of Science, University of Zagreb, Rooseveltov trg
6, HR/​10000 Zagreb, Croatia. zcifrek@zesoi.fer.hr

Saturated water solutions of calcium chloride, calcium bromide (densities 1.30
kg x dm(/​3) and 1.61 kg x dm(/​3), respectively) and their 1:1 mixture have been
commonly used as oil industry "high/​density brines." In our experiment they were
added to tap water in amounts appropriate to achieve concentrations of 0.025,
0.05, 0.075, and 0.1 mol x dm(/​3) to study their cytotoxic effect on the root
tip cells of shallot ( Allium cepa L. var. ascalonicum). All tested solutions in
concentrations of 0.075 and 0.1 mol x dm(/​3) caused significant inhibition of
shallot root growth. CaBr (2) showed this effect in concentration 0.05 mol x
dm(/​3). The investigated solutions in all concentrations applied decreased
mitotic activity in root tip cells. The most of mitotic abnormalities were the
consequence of spindle failure and chromosome stickiness. Furthermore, the cell
microtubules were investigated by indirect immunofluorescence to confirm that
most abnormalities observed were the consequence of spindle failure. The present
study, as well as previously done Lemna tests and Chlorella tests showed that
investigated samples have certain effects on plants, so constant control of
their presence in the environment is needed.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12202923 [PubMed /​ indexed for MEDLINE]

217: J Chromatogr A. 2002 Jul 19;963(1/​2):89/​93.

Aroma analysis of fresh and preserved onions and leek by dual solid/​phase
microextraction/​liquid extraction and gas chromatography/​mass spectrometry.

Mondy N, Duplat D, Christides JP, Arnault I, Auger J.

University Francois Rabelais, Institut de Recherche sur la Biologie de
l'Insecte, UMR CNRS 6035, Tours, France.

The lachrymatory factor (thiopropanal/​S/​oxide) was directly analysed on fresh
onion (Allium cepa) juice by solid/​phase microextraction (polyacrylate fibre)
using a fast routine GC/​MS method on a 10 m x 0.32 mm I.D. (4 microm thick
polydimethylsiloxane film) column with splitless mode injection. The
identification and quantification of thiosulphinates and zwiebelanes were
obtained on the same juice extracted by diethyl ether after 80 min maceration
using the same GC/​MS method. Selected ion recording enhanced the differentiation
possibilities and the detection limits. This dual method was used to evaluate
flavour differences between onion and shallot varieties as it provides accurate
profiles of all initially formed compounds. Moreover, this method allowed us to
compare qualitatively and quantitatively transformed products: frozen,
freeze/​dried powders and sterilised products. Excepting the lachrymatory factor,
frozen onion compounds were similar compared to those of fresh onion sample.
Conversely, the other transformed samples have lost most of the initially formed
compounds and produced mainly di/​ and trisulphides corresponding to the
degradation of thiosulphinates and zwiebelanes. These dramatic changes can
explain the very different flavours of these manufactured products compared to
fresh material.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12188005 [PubMed /​ indexed for MEDLINE]

218: Hereditas. 2002;136(1):13/​8.

Genotoxicity of maleic hydrazide, acridine and DEHP in Allium cepa root cells
performed by two different laboratories.

Rank J, Lopez LC, Nielsen MH, Moretton J.

Department of Environment, Technology and Social Studies, Roskilde University,
Denmark. jr@ruc.dk

The purpose of this paper was to compare the results of the Allium cepa
chromosome aberration assay between two laboratories under the same test
protocol and at the same time, use chemicals and onions obtained in their own
homeland. For this study three chemicals were selected:
di(2/​ethylhexyl)phthalate (DEHP), maleic hydrazide, and acridine. Both
laboratories found genotoxicity with a positive dose/​response relationship for
maleic hydrazide and acridine. However, for DEHP the results were quite
different/​/​one of the laboratories found this compound not genotoxic but the
other found a positive response. Although the comparative study was inconclusive
for DEHP, it was successful for the maleic hydrazide, acridine and also for the
positive control (methyl methanesulfonate). Further studies need to be performed
in the case of DEPH.

PMID: 12184484 [PubMed /​ indexed for MEDLINE]

219: J Dermatol. 2002 Jun;29(6):343/​6.

Onion juice (Allium cepa L.), a new topical treatment for alopecia areata.

Sharquie KE, Al/​Obaidi HK.

Department of Dermatology and Venereology, Baghdad Teaching Hospital, Iraq.

Alopecia areata is a patchy, non/​scarring hair loss condition. Any hair/​bearing
surface may be involved, and different modalities of treatment have been used to
induce hair regrowth. This study was designed to test the effectiveness of
topical crude onion juice in the treatment of patchy alopecia areata in
comparison with tap water. The patients were divided into two groups. The first
group [onion juice treated] consisted of 23 patients, 16 males (69.5%) and 7
females (30.5%). Their ages ranged between 5/​42 years with a mean of 22.7 years.
The second group [control; tap/​water/​treated] consisted of 15 patients, 8 males
(53.3%) and 7 females (46.6%). Their ages ranged between 3/​35 years with a mean
of 18.3 years. The two groups were advised to apply the treatment twice daily
for two months. Re/​growth of terminal coarse hairs started after two weeks of
treatment with crude onion juice. At four weeks, hair re/​growth was seen in 17
patients (73.9%), and, at six weeks, the hair re/​growth was observed in 20
patients (86.9%) and was significantly higher among males (93.7%) compared to
females (71.4%) P<0.0001. In the tap/​water treated/​control group, hair re/​growth
was apparent in only 2 patients (13%) at 8 weeks of treatment with no sex
difference. The present study showed that the use of crude onion juice gave
significantly higher results with regard to hair re/​growth than did tap water
(P<0.0001), and that it can be an effective topical therapy for patchy alopecia
areata.

Publication Types:
Clinical Trial
Controlled Clinical Trial

PMID: 12126069 [PubMed /​ indexed for MEDLINE]

220: Environ Toxicol. 2002;17(3):250/​7.

Quality of water types in Ukraine evaluated by WaterTox bioassays.

Arkhipchuk VV, Malinovskaya MV.

Institute of Colloid Chemistry and Water Chemistry, Ukrainian Academy of
Sciences, Vernadsky Boulevard 42, 03680, Kiev 142, Ukraine. arvic@nbi.com.ua

The quality of river, ground/​, and tap water was analyzed using the basic set of
WaterTox bioassays [Daphnia (Daphnia magna), Hydra (Hydra attenuata), and
lettuce (Lactuca sativa)] as well as two additional bioassays, onion (Allium
cepa) and microalga (Selenastrum gracile). Samples of these waters were also
concentrated fivefold using a solid/​phase procedure. The results of the Daphnia
and Hydra bioassays showed that the winter and spring concentrated and
nonconcentrated samples from the Dnieper and Desna rivers, the main water supply
sources for Kiev, were nontoxic. In spring, after concentration, the two river
samples brought about the same relative decrease in the lettuce root length (by
35%, p < 0.001), where the Desna River sample considerably reduced (by 79.1%, p
< 0.001) the number of microalga cells. Samples of groundwater from countryside
wells studied in autumn in several villages of the Kiev region were toxic mainly
to Hydra (sublethal effects were found in 11%/​78%) and lettuce (the root length
decreased 15%/​56%). Studies of tap water samples from two of the largest cities
of Ukraine, Kiev and Kharkiv, were found to be nontoxic to both plants, lettuce
and onion, but showed increased sublethal and lethal effects on both animals,
Daphnia and Hydra, as well as a reduced number of microalgae. Different
bioassays were sensitive to varying degrees to different water types. This
reinforces the necessity of using sets of bioassays in toxicity evaluation. In
general, all the tested water samples demonstrated some toxicity. These data
suggest that drinking water quality in Ukraine needs improvement. Copyright 2002
Wiley Periodicals, Inc.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12112633 [PubMed /​ indexed for MEDLINE]

221: Environ Toxicol. 2002;17(3):187/​94.

A novel nucleolar biomarker in plant and animal cells for assessment of
substance cytotoxicity.

Arkhipchuk VV, Garanko NN.

Institute of Colloid Chemistry and Water Chemistry, Ukrainian Academy of
Sciences, Vernadsky Boulevard 42, 03680, Kiev 142, Ukraine. arvic@nbi.com.ua

The cytotoxicity of three substances (mercury(II), metolachlor, and
4/​nitroquinoline/​N/​oxide) was assessed with a set of nucleolar parameters: the
average number of nucleoli, the average volume of a single nucleolus, and the
proportion of cells with heteromorphic/​paired nucleoli (PNhet). Their toxic
impact was studied on cells of animal and plant test organisms: onion (Allium
cepa), lettuce (Lactuca sativa), and hydra (Hydra attenuata). In general, at
concentrations near IC/LC(50) the three chemicals produced similar cytogenetic
effects after 30/​360 min of contact. For instance, in plant cells (Allium cepa
and Lactuca sativa) the toxicants increased the percentage of cells with PNhet,
decreased the volume of single nucleoli, and exerted no significant impact on
the nucleolar number. In animal cells (Hydra attenuata), they reduced the size
of nucleoli, produced no effect on the number of nucleoli, but decreased the
share of cells with PNhet. Also, the chemicals affected the cells of the three
test organisms to different degrees. Thus, the effectiveness of our approach of
using nucleolar biomarker (use of the proposed set of parameters and time
schedule of several determinations in the first hours of toxicant contact, etc.)
as a means of assessing cytotoxicity was confirmed. Copyright 2002 Wiley
Periodicals, Inc.

PMID: 12112626 [PubMed /​ indexed for MEDLINE]

222: Ann Bot (Lond). 2002 Apr;89(4):419/​25.

In vitro bulb development in shallot (Allium cepa L. Aggregatum Group): effects
of anti/​gibberellins, sucrose and light.

Le Guen/​Le Saos F, Hourmant A, Esnault F, Chauvin JE.

Universite de Bretagne Occidentale, Laboratoire de Biotechnologie et Physiologie
Vegetales, Brest, France.

Bulbing was studied in shallot plants cultured in vitro. Bulbing occurred under
a 16 h photoperiod with fluorescent + incandescent light and 30/​50 g 1(/​1)
sucrose in the culture medium. Exogenous gibberellin (10 microM GA3) inhibited
leaf and root growth and bulbing. When added to the medium at a concentration of
10 microM, three inhibitors of gibberellin biosynthesis (ancymidol, flurprimidol
and paclobutrazol) promoted bulb formation and the percentage of bulbing. When
ancymidol was used in combination with GA3, it did not reverse the effect of GA3
applied alone. Under treatments with 30/​70 g l(/​1) sucrose, bulbing ratios
greater than those found in control plants were achieved by addition of
ancymidol, and bulb fresh weight was increased in the same way. Ancymidol caused
a 66% decrease in sucrose content in leaf bases but greatly increased the
glucose, fructose and fructan contents. The increase in fructan content by
ancymidol could result from the three/​fold rise in total [14C]sucrose uptake per
plant from the culture medium associated with a marked increase in leaf base
labelling at the expense of root labelling. The possible role of ancymidol is
discussed and evidence supports a major regulatory role for gibberellins in
bulbing.

PMID: 12096802 [PubMed /​ indexed for MEDLINE]

223: Mutat Res. 2002 Jul;511(3):207/​37.

Lycopersicon assays of chemical/radiation genotoxicity for the study of
environmental mutagens.

Grant WF, Owens ET.

Department of Plant Science, P.O. Box 4000, McGill University, Macdonald Campus,
Ste. Anne de Bellevue, Que., Canada H9X 3V9.

From a literature survey, 21 chemicals are tabulated that have been evaluated in
39 assays for their clastogenic effects in Lycopersicon. Nineteen of the 21
chemicals are reported as giving a positive reaction (i.e. causing chromosome
aberrations). Of these, five are reported positive with a dose response. In
addition, 23 assays have been recorded for six types of radiation, all of which
reacted positively. The results of 102 assays with 32 chemicals and seven types
of radiation tested for the induction of gene mutations are tabulated, as well
as 20 chemicals and/or radiation in combined treatments. The Lycopersicon
esculentum (2n=24) assay is a very good plant bioassay for assessing chromosome
damage both in mitosis and meiosis and for somatic mutations induced by
chemicals and radiations. The Lycopersicon bioassay has been shown to be as
sensitive and as specific an assay as other plant genotoxicity assays, such as
Hordeum vulgare, Vicia faba, Crepis capillaris, Pisum sativum and Allium cepa
and should be considered in further studies in assessing clastogenicity. Tests
using L. esculentum can be made for a spectrum of mutant phenotypes of which
many are identifiable in young seedlings.

Publication Types:
Comparative Study
Research Support, U.S. Gov't, Non/​P.H.S.
Review

PMID: 12088718 [PubMed /​ indexed for MEDLINE]

224: Plast Reconstr Surg. 2002 Jul;110(1):177/​83; discussion 184/​6.

Effect of Mederma on hypertrophic scarring in the rabbit ear model.

Saulis AS, Mogford JH, Mustoe TA.

Division of Plastic and Reconstructive Surgery, Northwestern University Medical
School, Galter Pavilion, 675 N Saint Claire, Chicago, IL 60611, USA.

Currently accepted conservative treatments of hypertrophic scars are limited to
steroid injections, radiation therapy, and silicone occlusive therapy. However,
the use of Mederma for these problematic lesions has become quite prevalent in
the clinical setting. Little scientific evidence exists to support the efficacy
of this product in reducing hypertrophic scars. The aim of this study was to
study the effects of Mederma on hypertrophic scars in the rabbit hypertrophic
scar model, allowing the histologic quantification of scar elevation, dermal
collagen organization, vascularity, and inflammation and the gross examination
of scar erythema. Full/​thickness wounds down to cartilage, four per ear, were
created in four New Zealand White rabbits, for a total of 32 scars. Twenty/​eight
days after the initial wounding, the hypertrophic scars were photographed, and
treatment of half of the scars on each ear was begun with Mederma three times
per day for a total of 4 weeks. The untreated scars served as control scars and
were left exposed to air. After 4 weeks of treatment, the scars were once again
photographed. The rabbits were then killed, and the scars were analyzed
histologically. The pretreatment and posttreatment photographs were compared by
using computer quantification of magenta, yellow, and cyan expression within the
scars.Histologic analysis demonstrated no significant reduction in scar
hypertrophy or scar elevation index. However, a significant improvement in
dermal collagen organization was noted on comparing Mederma/​treated scars with
untreated control scars (p < 0.05). No significant difference in dermal
vascularity or inflammation was noted. Computer analysis of the scar photographs
demonstrated no significant reduction in scar erythema with Mederma treatment.
The active product in Mederma, allium cepa, has as its derivative quercetin, a
bioflavonoid noted for its antiproliferative effects on both normal and
malignant cells, and its antihistamine release effects. These properties could
theoretically prove beneficial in reversing the inflammatory and proliferative
responses noted in hypertrophic scars. Despite the authors' inability to
demonstrate a reduction in scar hypertrophy, the improvement in collagen
organization noted in the Mederma/​treated scars suggests it may have an effect
on the pathophysiology of hypertrophic scar formation.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12087249 [PubMed /​ indexed for MEDLINE]

225: Tsitologiia. 2002;44(2):120/​30.

[Disruption of organization of mitotic microtubules in root meristem cells of
Allium cepa induced by chloral hydrate]

[Article in Russian]

Smirnova EA, Svetlitskaia OM, Chentsov IuS.

Cytology and Histology Group, Biology Department, Moscow State University.

Data are presented on the effect of chlorahydrate on microtubule organization in
the root meristem of Allium cepa. Our studies show that an incomplete
preprophase band commonly appears during G2/​prophase transition, yet the major
effect is the lack of perinuclear microtubules, leading to inhibition of the
prophase spindle formation and transition to C/​mitosis. Upon chloralhydrate
treatment of metaphase cells, we found cells with chromosomes regularly aligned
within the metaphase plate and differently disorganized mitotic spindles.
Concurrently, C/​metaphase cells with remnants of kinetochore fibers were
present. In addition, normal bipolar and abnormal irregular types of chromosome
segregation were detected, this representing multipolar and diffuse anaphases.
The major difference between them is the presence of polar microtubules during
multipolar anaphase, and their lacking during diffuse anaphase. Alternatively,
microtubule clusters between segregated groups of chromosomes are typical for
cells with diffuse anaphase. During bipolar anaphase, excessive aster/​like
microtubules emanate from the spindle poles, and in telophase accessory
phragmoplasts are observed at the cell periphery. The formation of incomplete
phragmoplasts was observed after normal bipolar and abnormal chromosome
segregation. We conclude that chloralhydrate may affect the nuclear surface
capability to initiate the growth of perinuclear microtubules, thus blocking the
prophase spindle formation. It also disturbs the spatial interaction between
microtubules, which is crucial for the formation and functioning of various
microtubular systems (preprophase band, spindle and phragmoplast).

Publication Types:
English Abstract

PMID: 12053762 [PubMed /​ indexed for MEDLINE]

226: J Theor Biol. 2002 Mar 21;215(2):201/​13.

Modelling complex populations formed by proliferating, quiescent and
quasi/​quiescent cells: application to plant root meristems.

Lopez/​Sanchez J, Murciano A, Lahoz/​Beltra R, Zamora J, Gimenez/​Abian NI,
Lopez/​Saz JF, De La Torre C, Canovas JL.

Departamento de Matematica Aplicada (Biomatematica), Universidad Complutense,
Madrid, 28040, Spain. lopezj@eucmax.sim.ucm.es

A proliferating population of cells may be considered complex when its
proliferative or growth fraction P is lower than 1 and/or when it is formed by
subpopulations with different mean cycle times. The present paper shows that in
such complex populations exponential growth is consistent with a steady/​state
distribution of cells. Obviously, when P=1 then cell distribution is only a
function of cell age. An analytical model has been developed to study complex
populations including both quiescent fractions formed by cells with unreplicated
genome (G(0) cells) and cells with fully duplicated chromosomes (Q(2) cells).
The model also considers those quasi/​quiescent cells in their last transit
through G(1) and S (Q(1) and Q(s) cells) before becoming quiescent. In order to
solve the difficulties of a direct analysis of the whole population, its kinetic
parameters have been obtained by studying the negative exponential distribution
of two subpopulations: one formed by the proliferating cells and another formed
by the quasi/​quiescent cells. Additionally, the model could be applied when
quiescence is initiated at any other cycle phase different from G(1) and G(2),
for instance, cells in the process of replicating their DNA or being at any
other mitotic phases. The utility of the method was illustrated in populations
which constitute the root meristems of both Allium cepa L. and Pisum sativum L.
Three facts should be stressed: (1) the method seems to be rather powerful
because it can be carried out from different sets of experimentally measured
parameters; (2) the rate of division and, therefore, the population doubling
time can be easily estimated by this method; and (3) it also allows the
determination of the amount of cells that had become quiescent either before
they had replicated their DNA (G(0)) or after having completed their replication
(Q(2)), as well as those quasi/​quiescent cells which are progressing throughout
their last pre/​replicative and replicative periods (thus Q(1) and Q(s),
respectively). Copyright 2002 Elsevier Science Ltd. All rights reserved.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12051974 [PubMed /​ indexed for MEDLINE]

227: J Egypt Soc Parasitol. 2002 Apr;32(1):271/​83.

Effect of Allium cepa and Allium sativum feeding on glucose, glycogen, protein
bands profile and phenol oxidase activity in Biomphalaria alexandrina.

Mantawy MM, Mahmoud AH.

Department of Medicinal Chemistry, National Research Centre, Dokki, Cairo,
Egypt.

Feeding B. alexandrina on onion and garlic powder (Allium cepa and Allium
sativum) separately exert some biological and biochemical changes. The effect of
the two plants on glucose and glycogen which are the energy fuel of the snails,
and on phenol oxidase (PO) activity after 1, 2, 3 and 7 days were studied.
Different protein bands were separated from the control and treated snails
haemolymph after 24 hours and one week by using SDS/​electrophoresis. The study
revealed that glucose and glycogen were decreased significantly after feeding on
onion and garlic. Also phenol oxidase (PO) activity was highly significantly
decreased after 2 and 7 days of feeding on garlic while feeding on onion
decreased the activity of the enzyme at all periods. Data obtained from
SDS/​electrophoresis showed variations in the different protein bands reflect the
enzymatic change in the snails' tissue. So, the snails' fecundity may be reduced
and in turn disturb the life cycle of schistosome parasite.

PMID: 12049262 [PubMed /​ indexed for MEDLINE]

228: Planta. 2002 Jun;215(2):220/​8. Epub 2002 Apr 20.

Accumulation of plant small heat/​stress proteins in storage organs.

Lubaretz O, Zur Nieden U.

Institut fur Pflanzenbiochemie, Halle, Weinberg 3, 06120 Halle, Germany.

Plant small heat/​stress proteins (sHSPs) have been shown to be expressed not
only after exposure to elevated temperatures, but also at particular
developmental stages such as embryogenesis, microsporogenesis, and fruit
maturation. This paper presents new data on the occurrence of sHSPs in
vegetative tissues, their tissue/​specific distribution, and cellular
localization. We have found sHSPs in 1/​year/​old twigs of Acer platanoides L. and
Sambucus nigra L. and in the liana Aristolochia macrophylla Lamk. exclusively in
the winter months. In tendrils of Aristolochia, sHSPs were localized in vascular
cambium cells. After budding, in spring, these proteins were no longer present.
Furthermore, accumulation of sHSPs was demonstrated in tubers and bulbs of
Allium cepa L., Amaryllis ( Hippeastrum hybridum hort.), Crocus albiflorus L.,
Hyacinthus orientalis L., Narcissus pseudonarcissus L., Tulipa gesneriana L.,
and Solanum tuberosum L. (potato). In potato tubers and bulb scales of Narcissus
the stress proteins were localized in the central vacuoles of storage parenchyma
cells. In order to obtain more information on a possible functional correlation
between storage proteins and sHSPs, the accumulation of both types of protein in
tobacco seeds during seed ripening and germination was monitored. The expression
of sHSPs and globulins started simultaneously at about the 17th day after
anthesis. During seed germination the sHSPs disappeared in parallel with the
storage proteins. Furthermore, in embryos of transgenic tobacco plants, which do
not contain any protein bodies or storage proteins, no sHSPs were found. Thus,
the occurrence of sHSPs in perennial plant storage organs seems to be associated
with the presence of storage proteins.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12029471 [PubMed /​ indexed for MEDLINE]

229: Planta. 2002 Jun;215(2):195/​204. Epub 2002 Mar 13.

Dynamics of replication foci and nuclear matrix during S phase in Allium cepa L.
cells.

Samaniego R, de la Torre C, Moreno Diaz de la Espina S.

Nuclear Matrix Laboratory, Centro de Investigaciones Biologicas, CSIC, Velazquez
114, 28006 Madrid, Spain.

The sequential organisation of replication foci during S phase in onion ( Allium
cepa) and their relationship to the nuclear matrix were investigated. To discern
their structural features and temporal firing sequence, immunodetection of
5/​bromo/​2'/​deoxyuridine (BrdU) was carried out after in vivo feeding in
synchronised cells released from a 14/​h/​long hydroxyurea block. Replication foci
consisted of small replication granules, called replisomes, which clustered
together. Analysis of synchronous binucleate cells that maintained in their two
nuclei the specular symmetry of distribution of sister chromosomes in anaphase,
showed that replication starts in small replication foci at the telomeric pole
(pattern I), though the telomeres themselves formed large foci that were
late/​replicating. The rDNA replication foci (pattern II) also become replicated
in early S phase. Replication of large foci, including the heterochromatin (IV),
occurred in late S phase and finished at the centromeric nuclear pole (pattern
V). Labelling of proliferating cell nuclear antigen (PCNA) in nuclear matrices,
prepared from S/​phase nuclei after extensive DNase digestion, demonstrated that
replication foci were always stably anchored to the nuclear matrix. Thus,
association with the nucleoskeleton is not exclusively mediated by the
replicating or nascent DNA. The overlapping of patterns I, II and III in the
nuclear matrix, in contrast to the results of BrdU localisation in nuclei,
suggests that PCNA becomes associated with the nuclear matrix before the
replication foci are operative, and remains bound during replication.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 12029468 [PubMed /​ indexed for MEDLINE]

230: Indian J Exp Biol. 2001 Aug;39(8):760/​6.

A comparative study on the beneficial effects of garlic (Allium sativum Linn),
amla (Emblica Officinalis Gaertn)and onion (Allium cepa Linn) on the
hyperlipidemia induced by butter fat and beef fat in rats.

Augusti KT, Arathy SL, Asha R, Ramakrishanan J, Zaira J, Lekha V, Smitha S,
Vijayasree VM.

Department of Medical Biochemistry, School of Medical Education, M.G.
University, Kottayam, India.

Three months feeding of butter fat (BUF) and beef (BF) separately as components
of diet at a level of 21% by weight for albino rats, significantly raised their
serum and tissue lipids, lipid peroxidation and activities of certain enzymes.
BUF was found to be more atherogenic than BF. On incorporation of 5% garlic,
amla or onion separately in the above diets, each of them ameliorated the
deleterious effects of the animal fats. A higher hyperlipidemic effect of BUF as
compared to that of BF may be due to the fact that the ratio of unsaturated to
saturated fats is lower for the former (0.56) than for the latter (0.75) and
also that the former is richer in cholesterol content than the latter. The order
of the curative effects of the vegetables are garlic>amla>onion. The better
hypolipidemic effects and correction of elevated levels of certain enzymes shown
by garlic and amla may be due to the facts that they contain comparatively
better active principles than that found in onions.

Publication Types:
Comparative Study

PMID: 12018576 [PubMed /​ indexed for MEDLINE]

231: Genetika. 2002 Apr;38(4):489/​96.

[Chromosome CPD(PI/DAPI)/​ and CMA/DAPI/​banding patterns in Allium cepa L.]

[Article in Russian]

Kim ES, Punina EO, Rodionov AV.

Komarov Botanical Institute, Russian Academy of Sciences, St. Petersburg, 197376
Russia.

Chromosome banding patterns of Allium cepa L. were obtained by using
fluorochrome combinations chromomycin A3 (CMA) + 4',6/​diamidino/​2/​phenylindole
(DAPI), DAPI + actinomycin D (AMD) and propidium iodide (PI) + DAPI. In A. cepa,
telomeric heterochromatin displayed dull fluorescence after staining with DAPI
and DAPI/AMD. After staining with the GC/​specific CMA and AT/​specific DAPI, the
CMA/​positive fluorescence of the NOR region and the telomeric bands of
C/​heterochromatin was observed. In combination with DAPI, PI, a dye with low
AT/GC specificity, produced almost uniform fluorescence of chromosomal arms and
heterochromatin, whereas the NOR/​adjoining regions displayed bright
fluorescence. Denaturation of chromosomal DNA (95 degrees C for 1/​3 min)
followed by renaturation in the 2 x SSC buffer (37 degrees C, 12 h) altered the
chromosome fluorescence patterns: specific PI/​positive bands appeared and the
contrast of CMA/​banding increased. Bright fluorescence of the NOR and adjoining
regions was also observed in the case. Three/​minute denaturation led also to a
bright PI/​positive fluorescence of telomeric heterochromatin. The denaturation
of chromosomal DNA before staining results in changes of the DAPI fluorescence
pattern and in the appearance of DAPI fluorescence in GR/​rich NOP regions. The
mechanisms underlying the effects of denaturation/renaturation procedures on
chromosome banding patterns obtained with different fluorochromes are discussed.

Publication Types:
Comparative Study
English Abstract

PMID: 12018166 [PubMed /​ indexed for MEDLINE]

232: J Ethnopharmacol. 2002 Jun;81(1):81/​100.

Medicinal plants of India with anti/​diabetic potential.

Grover JK, Yadav S, Vats V.

Department of Pharmacology, All India Institute of Medical Sciences, Ansari
Nagar, New Delhi/​110049, India. jkgrover@hotmail.com

Since ancient times, plants have been an exemplary source of medicine. Ayurveda
and other Indian literature mention the use of plants in treatment of various
human ailments. India has about 45000 plant species and among them, several
thousands have been claimed to possess medicinal properties. Research conducted
in last few decades on plants mentioned in ancient literature or used
traditionally for diabetes have shown anti/​diabetic property. The present paper
reviews 45 such plants and their products (active, natural principles and crude
extracts) that have been mentioned/used in the Indian traditional system of
medicine and have shown experimental or clinical anti/​diabetic activity. Indian
plants which are most effective and the most commonly studied in relation to
diabetes and their complications are: Allium cepa, Allium sativum, Aloe vera,
Cajanus cajan, Coccinia indica, Caesalpinia bonducella, Ficus bengalenesis,
Gymnema sylvestre, Momordica charantia, Ocimum sanctum, Pterocarpus marsupium,
Swertia chirayita, Syzigium cumini, Tinospora cordifolia and Trigonella foenum
graecum. Among these we have evaluated M. charantia, Eugenia jambolana, Mucuna
pruriens, T. cordifolia, T. foenum graecum, O. sanctum, P. marsupium, Murraya
koeingii and Brassica juncea. All plants have shown varying degree of
hypoglycemic and anti/​hyperglycemic activity.

Publication Types:
Review

PMID: 12020931 [PubMed /​ indexed for MEDLINE]

233: J Agric Food Chem. 2002 May 8;50(10):2884/​90.

Characterization of some Allium hybrids by aroma precursors, aroma profiles, and
alliinase activity.

Keusgen M, Schulz H, Glodek J, Krest I, Kruger H, Herchert N, Keller J.

Institut fur Pharmazeutische Biologie, Universitat Bonn, Nussallee 6, D/​53115
Bonn, Germany. M.Keusgen@uni/​bonn.de

Various Allium hybrids, obtained by the crossbreeding of Allium cepa (onion) as
the mother plant and six taxonomically distant wild species obtained by embryo
rescue, were investigated with special respect to their individual profiles of
cysteine sulfoxides as well as enzymically and nonenzymically formed aroma
substances. Alliinase (EC 4.4.1.4) catalyzes the conversion of odorless
(+)/​S/​alk(en)yl/​L/​cysteine sulfoxides into volatile thiosulfinates. These
thiosulfinates were converted to a variety of sulfides by steam distillation.
SPME/​gas chromatography (GC) and high/​performance liquid chromatography (HPLC)
used for the analysis of aroma components and their precursors permitted a high
sample throughput, so that numerous gene bank accessions and Allium breeding
materials were analyzed within a comparatively short time. Cysteine sulfoxides
as well as alliinase activity were found in all investigated samples at
different levels, but (+)/​S/​methyl/​L/​cysteine sulfoxide (methiin) was the most
abundant sulfoxide present. (+)/​S/​(trans/​1/​Propenyl)/​L/​cysteine sulfoxide
(isoalliin) is typical for onion and was found in all investigated hybrids. The
pattern of the other cysteine sulfoxides depended strongly on the parent plants
used. The profile of aroma components corresponded with the related pattern of
aroma precursors (cysteine sulfoxides). Successful hybridization was proven by
randomly amplified polymorphic DNA analysis. Together with these established
marker techniques, HPLC and SPME/​GC analysis provide support to breeding
projects designed to improve the health and aroma properties of Allium hybrids.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11982415 [PubMed /​ indexed for MEDLINE]

234: Protoplasma. 2002 Feb;219(1/​2):82/​8.

Sesquiterpene lactone dehydroleucodine selectively induces transient arrest in
G2 in Allium cepa root meristematic cells.

Lopez ME, Giordano OS, Lopez LA.

Instituto de Histologia y Embriologia, Facultad de Ciencias Medicas, Universidad
Nacional de Cuyo, Casilla de correo 56, 5500 Mendoza, Argentina.

Dehydroleucodine is a sesquiterpene lactone recently isolated from aerial parts
of a medicinal herb, Artemisia douglasiana Besser. We have previously shown that
25 and 100 microM dehydroleucodine slowed down onion root growth by 30 and 70%,
respectively, affecting neither cell viability nor cell elongation. In the
present study we analyze the effect of dehydroleucodine on cell cycle phases in
onion (Allium cepa L.) root meristematic cells synchronized with caffeine or
caffeine and hydroxyurea. Synchronized root cells treated with 100 and 200
microM dehydroleucodine present an interphase lengthening of 5.2 h and 8.2 h,
respectively. The S/​phase length, estimated by [3H]thymidine incorporation
assay, was 6 h for both control roots and roots that had been immersed in
dehydroleucodine. The peak of [3H]leucine incorporation was observed 6 h after
release from synchronization in controls and in dehydroleucodine/​treated roots,
indicating that protein synthesis in G2 was not affected. Thus, these results
show that dose/​dependently dehydroleucodine selectively induces a transient
arrest of meristematic cell in G2 and that dehydroleucodine can be used
experimentally as a cell cycle suppressor.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11926070 [PubMed /​ indexed for MEDLINE]

235: J Agric Food Chem. 2002 Mar 27;50(7):1904/​10.

Flavonoid and carbohydrate contents in Tropea red onions: effects of homelike
peeling and storage.

Gennaro L, Leonardi C, Esposito F, Salucci M, Maiani G, Quaglia G, Fogliano V.

Istituto Nazionale di Ricerca per gli Alimenti e la Nutrizione, Via Ardeatina
546, 00178 Roma, Italy. laura.gen@libero.it

The content of anthocyanins, flavonols, and carbohydrates of Tropea red onions
(Allium cepa L.) was determined by HPLC and HPLC/​MS. Cyanidin derivatives
constitute >50% of total anthocyanins, but delphinidin and petunidin
derivatives, which have not been reported in red onions thus far, were also
detected. The flavonoid distribution in the different layers of the bulbs
indicates that, after homelike peeling, the edible portion contains 79% of the
total content of quercetin 4'/​glucoside but only 27% of the anthocyanins.
Storage of onions for 6 weeks in different conditions, all of them mimicking
home storage habits, resulted in a decrease to 64/​73% of total anthocyanins. The
same trend was verified for the total antioxidant activity, which was reduced to
29/​36%. A decrease in glucose and fructose content correlated with anthocyanin
degradation was also observed. Storage at low temperature seems to better
preserve the onion anthocyanins.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11902931 [PubMed /​ indexed for MEDLINE]

236: Environ Res. 2002 Jan;88(1):30/​5.

Effect of cadmium on the nucleoli of meristematic cells of onion Allium cepa L:
an ultrastructural study.

Marcano L, Carruyo I, Del Campo A, Montiel X.

Departamento de Bioloia, Facultad Experimental de Ciencias, Universidad del
Zulia, Maracaibo, Estado Zulia, Venezuela.

This study of the effect of cadmium on nucleolar ultrastructure was carried out
with meristematic cell populations of Allium cepa L. Meristems, grown at 25
degrees C, were treated with 10 ppm cadmium chloride. Conventional and silver
staining techniques were carried out, and the ultrastructure was analyzed using
electron microscopy. Observation showed alterations in the nucleoli of the cells
that had been treated with cadmium and this effect varied according to the time
of exposure to the metal. After 4h of treatment, nucleolar segregation was
observed in interphase, probably because of the effect of cadmium on the
synthesis of ribosomal RNA precursors. A decrease in the fibrillar to granular
component ratio also occurred in the cells exposed to Cd2+ for 8 h. Some changes
were observed in the G1 cells; their chromatin still remained very condensed,
and prenucleolus bodies remained scattered within the nucleus. At the same time,
there was a large amount of interchromatin granules. These changes produced by
cadmium resembled those produced during inhibition of RNA synthesis. The
fibrillar bodies, another morphologic feature, resulting from a blocked
transcription, were also evidenced. All these observations suggest that one of
the ways that cadmium exercises its toxicity is by altering the biosynthesis of
the preribosomal RNA precursor.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11896665 [PubMed /​ indexed for MEDLINE]

237: Eur J Cell Biol. 2002 Jan;81(1):9/​16.

DNA catenations that link sister chromatids until the onset of anaphase are
maintained by a checkpoint mechanism.

Gimenez/​Abian JF, Clarke DJ, Gimenez/​Martin G, Weingartner M, Gimenez/​Abian MI,
Carballo JA, Diaz de la Espina SM, Bogre L, De la Torre C.

Centro de Investigaciones Biologicas, Consejo Superior de Investigaciones
Cientificas, Madrid, Spain.

Treatment of Allium cepa meristematic cells in metaphase with the topoisomerase
II inhibitor ICRF/​193, results in bridging of the sister chromatids at anaphase.
Separation of the sisters in experimentally generated acentric chromosomal
fragments was also inhibited by ICRF/​193, indicating that some non/​centromeric
catenations also persist in metaphase chromosomes. Thus, catenations must be
resolved by DNA topoisomerase II at the metaphase/​to/​anaphase transition to
allow segregation of sisters. A passive mechanism could maintain catenations
holding sisters until the onset of anaphase. At this point the opposite tension
exerted on sister chromatids could render the decatenation reaction physically
more favorable than catenation. But this possibility was dismissed as acentric
chromosome fragments were able to separate their sister chromatids at anaphase.
A timing mechanism (a common trigger for two processes taking different times to
be completed) could passively couple the resolution of the last remaining
catenations to the moment of anaphase onset. This possibility was also discarded
as cells arrested in metaphase with microtubule/​destabilising drugs still
displayed anaphase bridges when released in the presence of ICRF/​193. It is
possible that a checkpoint mechanism prevents the release of the last
catenations linking sisters until the onset of anaphase. To test whether cells
are competent to fully resolve catenations before anaphase onset, we generated
multinucleate plant cells. In this system, the nuclei within a single
multinucleate cell displayed differences in chromosome condensation at
metaphase, but initiated anaphase synchronously. When multinucleates were
treated with ICRF/​193 at the metaphase/​toanaphase transition, tangled and
untangled anaphases were observed within the same cell. This can only occur if
cells are competent to disentangle sister chromatids before the onset of
anaphase, but are prevented from doing so by a checkpoint mechanism.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11893079 [PubMed /​ indexed for MEDLINE]

238: Plant Physiol. 2002 Mar;128(3):1031/​45.

Simultaneous visualization of peroxisomes and cytoskeletal elements reveals
actin and not microtubule/​based peroxisome motility in plants.

Mathur J, Mathur N, Hulskamp M.

Botanical Institute III, University of Koln, Gyrhofstrase 15, 50931 Cologne,
Germany.

Peroxisomes were visualized in living plant cells using a yellow fluorescent
protein tagged with a peroxisomal targeting signal consisting of the SKL motif.
Simultaneous visualization of peroxisomes and microfilaments/microtubules was
accomplished in onion (Allium cepa) epidermal cells transiently expressing the
yellow fluorescent protein/​peroxi construct, a green fluorescent protein/​mTalin
construct that labels filamentous/​actin filaments, and a green fluorescent
protein/​microtubule/​binding domain construct that labels microtubules. The
covisualization of peroxisomes and cytoskeletal elements revealed that, contrary
to the reports from animal cells, peroxisomes in plants appear to associate with
actin filaments and not microtubules. That peroxisome movement is actin based
was shown by pharmacological studies. For this analysis we used onion epidermal
cells and various cell types of Arabidopsis including trichomes, root hairs, and
root cortex cells exhibiting different modes of growth. In transient onion
epidermis assay and in transgenic Arabidopsis plants, an interference with the
actin cytoskeleton resulted in progressive loss of saltatory movement followed
by the aggregation and a complete cessation of peroxisome motility within 30 min
of drug application. Microtubule depolymerization or stabilization had no
effect.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11891258 [PubMed /​ indexed for MEDLINE]

239: Virology. 2001 Nov 25;290(2):249/​60.

Movement proteins (BC1 and BV1) of Abutilon mosaic geminivirus are cotransported
in and between cells of sink but not of source leaves as detected by green
fluorescent protein tagging.

Zhang SC, Wege C, Jeske H.

Department of Molecular Biology and Plant Virology, Biological Institute,
University of Stuttgart, Pfaffenwaldring 57, D/​70550 Stuttgart, Germany.

Two movement proteins (BV1 and BC1) facilitate the intra/​ and intercellular
transport of begomoviruses in plants. In contrast to other geminiviruses the
movement protein BC1 of Abutilon mosaic virus (AbMV) remained in the supernatant
after centrifuging plant extracts at 20,000 g. To test whether this unusual
behavior results from a distinct intracellular distribution of the protein, the
BC1 gene has been fused to the gene of green fluorescent protein (GFP). The
resulting plasmids were delivered into nonhost plants (Allium cepa) as well as
into mature and immature cells of host plants (Nicotiana tabacum, N.
benthamiana) by biolistic bombardment for transient expression in planta. BC1
directed GFP to two different cellular sites. In the majority of nonhost cells
as well as in mature cells of host leaves, BC1 was mainly localized in small
punctate flecks at the cell periphery or, to a lesser extent, around the
nucleus. In sink leaves of host plants, GFP:BC1 additionally developed disc/​like
structures in the cell periphery. Cobombardment of GFP:BC1 with its cognate
infectious DNA A and B did not change their subcellular distribution patterns in
source leaves but led to the formation of peculiar needle/​like structures in
sink leaves. The nuclear shuttle protein (BV1) of AbMV accumulated mainly inside
the nuclei as shown by immunohistochemical staining and GFP tagging. In sink
cells of host plants it was mobilized to the plasma membrane and to the nucleus
of the neighboring cell by coexpressed BC1, GFP:BC1, BC1:GFP, or after
cobombardment with the cognate viral DNA. Only under these conditions were
GFP:BC1 and BC1:GFP also found in the recipient cell.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11883189 [PubMed /​ indexed for MEDLINE]

240: J Agric Food Chem. 2002 Feb 27;50(5):1272/​7.

Antiradical activity of water soluble components in common diet vegetables.

Racchi M, Daglia M, Lanni C, Papetti A, Govoni S, Gazzani G.

Department of Experimental and Applied Pharmacology, Faculty of Pharmacy,
University of Pavia, via Taramelli 14, 27100 Pavia, Italy.

The antiradical activity of water/​soluble components contained in mushrooms
(Psalliota campestris), onions (Allium cepa), white cabbage (Brassica oleracea
var. alba), and yellow bell peppers (Capsicum annuum) against hydroxyl radicals
was tested in a chemical and biological system. The vegetable juices were
obtained by centrifugation of a vegetable homogenate processed at 2 degrees C or
heated at 102 degrees C. The chemical system consisted of a buffered reaction
mixture composed of Fe(III)/​EDTA, 2/​deoxy/​D/​ribose, ascorbic acid, and H(2)O(2)
generating the hydroxyl radical. The antiradical activity was expressed as an
inhibition of deoxyribose degradation. The biological system consisted of IMR32
neuroblastoma cells exposed to H(2)O(2) in the presence or absence of the
vegetable juices. Cells were pretreated for either 24 h or 1 h with the
vegetable juices, and reduction of
3/​(4,5/​dimethylthiazol/​2/​yl)/​2,5/​diphenyltetrazolium bromide (MTT) was used as a
cell viability assay. All vegetable juices inhibited the degradation of
deoxyribose and increased the viability of H(2)O(2) treated cells. Raw mushroom
juice proved to be the most active in both cases. Boiling significantly affected
the activity of mushroom juice, but did not change significantly the effect on
onions and yellow bell peppers, and partially increased the activity of white
cabbage juice. Mushroom antiradical activity was also confirmed by a
cytofluorimetric analysis.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11853517 [PubMed /​ indexed for MEDLINE]

241: Environ Toxicol Chem. 2002 Feb;21(2):309/​18.

Mutagenicity and disinfection by/​products in surface drinking water disinfected
with peracetic acid.

Monarca S, Richardson SD, Feretti D, Grottolo M, Thruston AD Jr, Zani C, Navazio
G, Ragazzo P, Zerbini I, Alberti A.

Department of Experimental and Applied Medicine, University of Brescia, Italy.
monarca@master.cci.unibs.it

The aims of this research were to study the influence of peracetic acid (PAA) on
the formation of mutagens in surface waters used for human consumption and to
assess its potential application for the disinfection of drinking water. The
results obtained using PAA were compared to those found with sodium hypochlorite
(NaClO) and chlorine dioxide (ClO2). The Ames test, root anaphase aberration
assay, and root/micronuclei assay in Allium cepa and Tradescantia/micronuclei
test were used to evaluate the mutagenicity of disinfected samples.
Microbiological tests were also performed, and disinfection by/​products (DBPs)
were identified using gas chromatography/mass spectrometry (GC/MS). A slight
bacterial mutagenicity was found in raw lake and river water, and similar
activity was detected in disinfected samples. A plant test revealed genotoxicity
in raw river water, and microbiological analysis showed that PAA has
bactericidal activity but lower than that of the other disinfectants. The DBPs
produced by PAA were mainly carboxylic acids, which are not recognized as
mutagenic, whereas the waters treated with the other disinfectants showed the
presence of mutagenic/carcinogenic halogenated DBPs. However, additional
experiments should be performed with higher concentrations of PAA and using
water with higher organic carbon content to better evaluate this disinfectant.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11833799 [PubMed /​ indexed for MEDLINE]

242: Mutat Res. 2002 Feb 15;514(1/​2):105/​13.

Clastogenicity of pentachlorophenol, 2,4/​D and butachlor evaluated by Allium
root tip test.

Ateeq B, Abul Farah M, Niamat Ali M, Ahmad W.

Gene/​Tox Laboratory, Division of Genetics, Department of Zoology, Aligarh Muslim
University, 202002, UP, Aligarh, India.

The meristematic mitotic cells of Allium cepa is an efficient cytogenetic
material for chromosome aberration assay on environmental pollutants. For
assessing genotoxicity of pentachlorophenol (PCP), 2,4/​dichlorophenoxyacetic
acid (2,4/​D) and 2/​chloro/​2,6/​diethyl/​N/​(butoxymethyl) acetanilide (butachlor),
50% effective concentration (EC(50)), c/​mitosis, stickiness, chromosome breaks
and mitotic index (MI) were used as endpoints of genotoxicity. EC(50) values for
PCP and butachlor are 0.73 and 5.13 ppm, respectively. 2,4/​D evidently induced
morphological changes at higher concentrations. Some changes like crochet hooks,
c/​tumours and broken roots were unique to 2,4/​D at 5/​20 ppm. No such
abnormalities were found in PCP and butachlor treated groups, however, root
deteriorated and degenerated at higher concentrations (<3 ppm) in PCP. MI in
2,4/​D showed a low average of 14.32% followed by PCP (19.53%), while in
butachlor it was recorded 71.6%, which is near to the control value. All
chemicals induced chromosome aberrations at statistically significant level. The
highest chromosome aberration frequency (11.90%) was recorded in PCP at 3 ppm.
Large number of c/​mitotic anaphases indicated that butachlor acts as potent
spindle inhibitor, whereas, breaks, bridges, stickiness and laggards were most
frequently found in PCP showing that it is a potent clastogen.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11815249 [PubMed /​ indexed for MEDLINE]

243: Indian J Biochem Biophys. 2001 Aug;38(4):277/​9.

Determination of antidiabetic activity in Allium cepa (onion) tissue cultures.

Kelkar SM, Kaklij GS, Bapat VA.

Radiation Biology Division, Bhabha Atomic Research Centre, Mumbai, India.
kelkar@apsara.barc.ernet.in

Seedling, seedling parts and callus cultures of onion were tested for their
antidiabetic activity by feeding the tissue/​extracts to diabetic rats. The
results indicated much higher antidiabetic activity in callus cultures as
compared to natural bulbs of onion. These results may be of pharmaceutical
significance since the callus can be used as an alternative source for the
isolation of antidiabetic compounds.

Publication Types:
Comparative Study

PMID: 11811626 [PubMed /​ indexed for MEDLINE]

244: J Exp Bot. 2002 Feb;53(367):333/​40.

The role of root system architecture and root hairs in promoting anchorage
against uprooting forces in Allium cepa and root mutants of Arabidopsis
thaliana.

Bailey PH, Currey JD, Fitter AH.

Department of Biology, University of York, PO Box 373, York YO10 5YW, UK.

The role played by lateral roots and root hairs in promoting plant anchorage,
and specifically resistance to vertical uprooting forces has been determined
experimentally. Two species were studied, Allium cepa (onion) which has a
particularly simple root system and two mutants of Arabidopsis thaliana, one
without root hairs (rhd 2/​1) and another with reduced lateral root branching
(axr 4/​2). Maximum strength of individual onion roots within a plant increased
with plant age. In uprooting tests on onion seedlings, resistance to uprooting
could be resolved into a series of events associated with the breakage of
individual roots. Peak pulling resistance was explained in a regression model by
a combination of a measure of plant size and the extent to which the uprooting
resistance of individual roots was additive. This additive effect is termed root
co/​operation. A simple model is presented to demonstrate the role played by root
co/​operation in uprooting resistance. In similar uprooting tests on Arabidopsis
thaliana, the mutant axr 4/​2, with very restricted lateral development, showed a
14% reduction in peak pulling resistance when compared with the wild/​type plants
of similar shoot dry weight. The uprooting force trace of axr 4/​2 was different
to that of the wild type, and the main axis was a more significant contributor
to anchorage than in the wild type. By contrast, the root hair/​deficient mutant
rhd 2/​1 showed no difference in peak pulling resistance compared with the wild
type, suggesting that root hairs do not normally play a role in uprooting
resistance. The results show that lateral roots play an important role in
anchorage, and that co/​operation between roots may be the most significant
factor.

Publication Types:
Comparative Study

PMID: 11807137 [PubMed /​ indexed for MEDLINE]

245: J Egypt Soc Parasitol. 2001 Dec;31(3):711/​23.

Potential effect of Allium cepa and Allium sativum on haemolymph of Biomphalaria
alexandrina, the intermediate host of Schistosoma mansoni.

Mantawy MI.

Department of Medicinal Chemistry, National Research Centre, Dokki, Cairo,
Egypt.

Biomphalaria alexandrina were fed on either Allium cepa or A. sativum to study
their effects on some biochemical parameters such as total proteins, free amino
acids and liver enzymes (ALT, ALP and AST) on egg laying activity of the snails.
The results revealed that ALP was highly significantly reduced in haemolymph of
snails that fed on either Allium cepa or A. sativum. Also, ALT and AST were
highly significantly reduced in haemolymph of snails that were fed on A. cepa
while those fed on A. sativum showed no change in ALT activity and a high
significant increase in AST activity. Total proteins were significantly
decreased in haemolymph of all treated snails whereas variations in free amino
acids contents were also observed. The reproductive activity of snails fed on
either Allium cepa or A. sativum was highly affected. In addition, growth rate
of newly hatched snails fed on either A. cepa or A. sativum was affected.
Exposure of snails to water containing either A. cepa or A. sativum caused snail
toxicity which may result from alterations in the snails' habitat.

PMID: 11775098 [PubMed /​ indexed for MEDLINE]

246: Environ Toxicol Chem. 2001 Dec;20(12):2749/​57.

Relationship between soil copper content and copper content of selected crop
plants in central Chile.

Badilla/​Ohlbaum R, Ginocchio R, Rodriguez PH, Cespedes A, Gonzalez S, Allen HE,
Lagos GE.

CIMM, Vitacura, Santiago, Chile.

A survey of copper levels in agricultural soils of central Chile revealed two
soil clusters/​one with a mean copper level of 162 mg/kg and one with a mean
copper level of 751 mg/kg of soil. Samples of soils from both soil clusters were
characterized on the basis of physicochemical characteristics, and copper
extractability was compared by saturation and CaCl2 extraction as well as an
acid/​leaching procedure (TCLP). We also measured the copper content of various
tissues of tomato (Lycopersicon esculentum) and onion (Allium cepa) crops
growing on these soils. Other than copper levels, soils from the two clusters
were quite similar, with slightly greater levels of molybdenum and cadmium in
the high/​copper soils. Within each cluster, extracted copper levels and total
soil copper levels were not correlated. However, the three extraction procedures
solubilized significantly more copper from the high/​Cu soils. Mineralogical
characterization of the soil particles and depth profiles of soil metal levels
in a subsample of sites suggested that highly insoluble copper ore and mining
wastes might account for the high copper levels. Neither total nor extractable
copper levels allowed statistical prediction of the levels of copper in plant
tissue. The edible tissues of both crops had the same mean copper content,
regardless of the copper soil level. However, copper contents of stems and
leaves were significantly higher for plants growing on the high/​Cu soils. These
results show that in these soils, high copper levels are associated with very
insoluble copper species and thus low bioavailability of copper to crop plants.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11764158 [PubMed /​ indexed for MEDLINE]

247: J Agric Food Chem. 2002 Jan 2;50(1):122/​8.

Structural carbohydrate differences and potential source of dietary fiber of
onion (Allium cepa L.) tissues.

Jaime L, Molla E, Fernandez A, Martin/​Cabrejas MA, Lopez/​Andreu FJ, Esteban RM.

Departamento de Quimica Agricola, Facultad de Ciencias, Universidad Autonoma de
Madrid (UAM), 28049 Madrid, Spain.

Onion tissues of three varieties were evaluated for dietary fiber (DF)
composition. Insoluble (IDF) and soluble (SDF) dietary fibers were subjected to
acid hydrolysis, and the resultant neutral sugars, uronic acids, and Klason
lignin were quantified. Brown skin exhibited the highest total dietary fiber
(TDF) content (65.8%) on a dry matter basis, followed by top (48.5%) and bottom
(38.6%), IDF being the main fraction found. The SDF:IDF ratio decreased from
inner to outer tissues. Brown skin and outer leaves byproducts appear to be the
most suitable sources of DF that might be used in food product supplementation.
The chemical composition reveals that cellulose and pectic polysaccharides were
the main components of onion DF in all tissues, although differences between
them were noticed. An increase in the uronic acids/neutral sugars ratio from
inner to outer tissues was found, suggesting that the galactan side chain shows
a DF solubilization role.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11754555 [PubMed /​ indexed for MEDLINE]

248: Minerva Stomatol. 2001 Nov/​Dec;50(11/​12):361/​71.

Evaluation of the clastogenic activity of some resins used in the prosthodontic
field.

[Article in English, Italian]

Gigola P, Monarca S, Feretti D, Zerbini I, D'Argenio D.

Head of Clinical Dentistry Department, Brescia University, Brescia, Italy.

BACKGROUND: Dental materials, in particular resins used in prosthetic,
orthodontic, conservative and gnathological dentistry, are frequently in
long/​term contact with the tissues of the mouth, and the chronic exposure to
these products of a significant proportion of the population means that the
release of genotoxic substances by dental resins must be evaluated. METHODS: For
this purpose, ten methyl metacrylate/​based resins, both cold/​ and
hot/​polymerising and all of frequent use in clinical practice, were prepared
following the indications in Standard UNI 9582/​2 now included in Standard ISO
10993. Genotoxicity was evaluated through the Tradescantia/micronuclei test.
RESULTS: By using the Tradescantia/micronuclei test, which detects aberrant
chromosomes by detecting micronuclei in flower tetrads, nine resins were found
not to the positive; one resin caused a significant increase in the frequency of
micronuclei compared to negative controls. CONCLUSIONS: The results of the
Tradescantia/micronuclei test, together with the results of tests cytotoxicity
and the Ames and Allium cepa tests performed in previous research, indicate a
need for further analyses of these resins for dental use, through other in vivo
and in vitro tests, in order to achieve certainty over the risk connected with
their use in human populations.

PMID: 11744882 [PubMed /​ indexed for MEDLINE]

249: J Protein Chem. 2001 Jul;20(5):361/​6.

A monomeric mannose/​binding lectin from inner shoots of the edible chive (Allium
tuberosum).

Lam YW, Ng TB.

Department of Biochemistry, Faculty of Medicine, The Chinese University of Hong
Kong, Hong Kong.

A mannose/​binding lectin was isolated from the inner shoots of the chive Allium
tuberosum. The procedure involved aqueous extraction, (NH4)2SO4 precipitation,
dialysis to remove (NH4)2SO4, affinity chromatography on mannose/​agarose, ion
exchange chromatography on SP/​Sepharose, gel filtration on Superdex 75, and ion
exchange chromatography on Mono S. Lectin activity was adsorbed on
mannose/​agarose, SP/​Sepharose, and Mono S. The lectin demonstrated a molecular
weight of 13 kDa in sodium dodecyl sulfate/​polyacrylamide gel electrophoresis
and gel filtration, indicating that it is a single/​chain protein. N/​terminal
sequence analysis revealed its remarkable homology to Allium cepa lectin and
similarity to a lesser extent to lectins from members of the Amaryllidaceae,
Orchidaceae, and Liliaceae. The lectin manifested mitogenic activity in murine
splenocytes and inhibitory activity against human immunodeficiency virus type 1
reverse transcriptase.

PMID: 11732687 [PubMed /​ indexed for MEDLINE]

250: Genes Genet Syst. 2001 Aug;76(4):251/​5.

BAC FISH analysis in Allium cepa.

Suzuki G, Ura A, Saito N, Do GS, Seo BB, Yamamoto M, Mukai Y.

Division of Natural Science, Osaka Kyoiku University, Kashiwara, Japan.
gsuzuki@cc.osaka/​kyoiku.ac.jp

Onion (Allium cepa L.; 1C=15,000 Mb) is an agriculturally important plant. The
genome of onion has been extensively studied at the conventional cytogenetic
level, but molecular analyses have lagged behind due to its large genome size.
To overcome this bottleneck, a partial bacterial artificial chromosome (BAC)
library of onion was constructed. The average insert size of the BAC library was
about 100 kb. A total of 48,000 clones, corresponding to 0.32 genome equivalent,
were obtained. Fluorescent in situ hybridization (FISH) screening resulted in
identification of BAC clones localized on centromeric, telomeric, or several
limited interstitial chromosomal regions, although most of the clones hybridized
with entire chromosomes. The partial BAC library proved to be a useful resource
for molecular cytogenetic studies of onion, and should be useful for further
mapping and sequencing studies of important genes of this plant. BAC FISH
screening is a powerful method for identification of molecular cytogenetic
markers in large/​genome plants.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11732634 [PubMed /​ indexed for MEDLINE]

251: Phytochemistry. 2001 Dec;58(7):1073/​81.

Potential allelochemicals from Sambucus nigra.

D'Abrosca B, DellaGreca M, Fiorentino A, Monaco P, Previtera L, Simonet AM,
Zarrelli A.

Dipartimento di Scienze della Vita, II Universita di Napoli, via Vivaldi 43,
I/​81100, Caserta, Italy.

Twenty/​four aromatic metabolites belonging to cyanogenins, lignans, flavonoids,
and phenolic glycosides were obtained from Sambucus nigra. Structures were
determined on the basis of their spectroscopic features. Two compounds have been
isolated and identified as (2S)/​2/​O/​beta/​D/​glucopyranosyl/​2/​hydroxyphenylacetic
acid and benzyl 2/​O/​beta/​D/​glucopyranosyl/​2,6/​dihydroxybenzoate. All the
compounds have been assayed on dicotyledons Lactuca sativa (lettuce) and
Raphanus sativus (radish) and monocotyledon Allium cepa (onion) to test their
stimulatory or inhibitory effects on seed germination and radicle elongation.
Cyanogenins have a mainly inhibiting effect while lignans stimulate the growth.
Some compounds show different effects on dicotyledons and monocotyledons.

PMID: 11730871 [PubMed /​ indexed for MEDLINE]

252: Genome. 2001 Oct;44(5):929/​35.

Interspecific chromosomal rearrangements in monosomic addition lines of Allium.

Barthes L, Ricroch A.

Universite de Paris XI, Centre National de la Recherche Scientifique UPRES/​A
8079, Laboratoire Ecologie des Populations et Communautes, Orsay, France.

Monosomic alien addition lines (MAALs) are useful for assigning linkage groups
to chromosomes. We examined whether the chromosomal rearrangements following the
introduction of a single onion (Allium cepa) chromosome into the Allium
fistulosum genome were produced by homeologous crossing over or by a
nonreciprocal conversion event. Among the monosomic lines available, 17 were
studied by fluorescent genomic in situ hybridisation, using total A. cepa
genomic DNA as the probe and total A. fistulosum genomic DNA as the competitor.
In this way, rearrangements such as chromosomal translocations between A. cepa
and A. fistulosum were identified as terminal regions consisting of tandem DNA
repeats. Homeologous crossing over between the two closely related genomes
occurred in 4 of the 17 lines, suggesting that such events are not rare. On the
basis of a detailed molecular cytogenetic characterisation, we identified true
monosomic alien addition lines for A. cepa chromosomes 3, 4, 5, 7, and 8 that
can reliably be used in genetic studies.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11681618 [PubMed /​ indexed for MEDLINE]

253: Tsitologiia. 2001;43(8):803/​8.

[Cytogenetic effects of separate and combined action of 232Th and Cd nitrates on
Allum cepa root meristem cells]

[Article in Russian]

Evseeva TI, Geras'kin SA, Khramova ES.

Biological Institute, Komi Research Center, Urals Department of RAS, 167896
Syktyvkar. evseeva@ib.komisc.ru

Effects of separate and combined action of 232Th and Cd on Allium cepa root tip
cells were investigated. It has been shown that cytogenetic effects of 232Th
results mainly from its ability to induce genome damages. Cadmium in the
examined concentration does not induce chromosomal vagrants, and this effect is
not intensified by the combined action of 232Th and Cd (with 232Th). Cd induced
increased aberrations of chromosome type frequency (1.5 times more than in
control group), and fragment frequence, while mitotic index was significantly
decreased. While taking into consideration the frequency of anaphase/​/​telophase
damages, and the number of aberrations per cell, the combined effects of 232Th
and Cd may be considered as synergic. The aberration type ratio, frequencies of
bridges and fragments, and also the level of proliferative activity of 232Th and
Cd in the presence of both ions were similar with the corresponding parameters
obtained when Cd acted alone. Possible mechanisms of formation of 232Th and Cd
synergic effects are discussed.

Publication Types:
English Abstract

PMID: 11601397 [PubMed /​ indexed for MEDLINE]

254: Tsitol Genet. 2001 Mar/​Apr;35(2):3/​10.

[Cytogenetic effects of toxic metal salts on apical meristem cells of Allium
cepa L. seed roots]

[Article in Russian]

Dovgaliuk AI, Kaliniak TB, Blium IaB.

Comparative analysis of the influence of the salts of Cd, Pb, Ni, Al, Cu and Zn
at concentrations 10(/​6)/​10(/​3) M on cytogenetic parameters of Allium cepa
apical meristem cells was carried out. It was shown that these metal compounds
could induce both the clastogenic and the aneugenic effects (including mitosis
and cytokinesis disturbances). Based on ability to cause the chromosome
aberrations the metal salts were arranged in such row of genotoxicity: ZnSO4 >
Pb(CH3COO)2 > Al(NO3)3 approximately NiSO4 > CdCl2 > CuSO4. The investigated
compounds of cadmium, lead, nickel and aluminum were found to be more effective
aneugens than clastogens. According to our data NiSO4 had the strongest
antimitotic activity (it increased the percentage of chromosome lagging of,
multipolar anaphases, C/​mitoses in 69.6 times, compared to the control). The
ability of other metal salts to induce such abnormalities decreased in the
range: CdCl2 > Al(NO3)3 > Pb(CH3COO)2 > CuSO4 > ZnSO4. Increasing of binuclear
cells on the slides was revealed after treatment by all tested substances,
however Ni sulfate was found as the strongest inducer of cytokinesis
abnormalities. Presented results allowed to suggest that cytoskeleton could be a
cell target for salts of some metals (especially for NiSO4).

Publication Types:
Comparative Study
English Abstract

PMID: 11589053 [PubMed /​ indexed for MEDLINE]

255: Tsitol Genet. 2001 Jan/​Feb;35(1):3/​9.

[Assessment of phyto/​ and cytotoxic effects of heavy metals and aluminum
compounds using onion apical root meristem]

[Article in Russian]

Dovgaliuk AI, Kaliniak TB, Blium IaB.

The effects of different concentrations (10(/​6)/​10(/​3) M) of salts of six metals
(cadmium, lead, nickel, aluminum, copper, and zinc) on the root growth of onion
(Allium cepa L.) seedling and cell division, chromosome and nucleus morphology
in root tip cells were studied. The obtained results showed that tested
compounds inhibit the root growth, reduce the mitotic activity of meristem cells
and cause the chromosome and nucleus irregularities. On the basis of these data
two rows of metal salt toxicity were proposed/​/​for effective concentrations
(EC50) of toxic action: CuSO4 > CdCl2 > NiSO4 > Pb(CH3COO)2 > Al(NO3)3 > ZnSO4,
and for sublethal and lethal effects of investigated substances: CuSO4 >
Pb(CH3COO)2 > CdCl2 > ZnSO4 > NiSO4 > Al(NO3)3.

Publication Types:
English Abstract

PMID: 11589041 [PubMed /​ indexed for MEDLINE]

256: Toxicol In Vitro. 2001 Aug/​Oct;15(4/​5):503/​9.

A test battery for the ecotoxicological evaluation of pentachlorophenol.

Repetto G, Jos A, Hazen MJ, Molero ML, del Peso A, Salguero M, Castillo PD,
Rodriguez/​Vicente MC, Repetto M.

National Institute of Toxicology, PO Box 863, 41080 Seville, Spain.
repetto@sev.inaltox.es

Experimental bioassays are currently used in ecotoxicology and environmental
toxicology to provide information for risk assessment evaluation of new
chemicals and to investigate their effects and mechanisms of action; in
addition, ecotoxicological models are used for the detection, control and
monitoring of the presence of pollutants in the environment. As a single
bioassay will never provide a full picture of the quality of the environment, a
representative, cost/​effective and quantitative test battery should be
developed. The effects of pentachlorophenol were studied using a battery of
ecotoxicological model systems, including immobilization of Daphnia magna,
bioluminiscence inhibition in the bacterium Vibrio fischeri, growth inhibition
of the alga Chlorella vulgaris, and micronuclei induction in the plant Allium
cepa. The inhibition of cell proliferation and MTT reduction were investigated
in Vero cells. Neutral red uptake, cell growth, MTT reduction, lactate
dehydrogenase leakage and activity were studied in the salmonid fish cell line
RTG/​2, derived from the gonad of rainbow trout. Pentachlorophenol was very toxic
for all biota and cells. The system most sensitive to pentachlorophenol, was
micronuclei induction in A. cepa, followed by D. magna immobilization,
bioluminescence inhibition in V. fischeri bacteria at 60 min and cell
proliferation inhibition of RTG/​2 cells at 72 h. Inhibition of cell
proliferation and MTT reduction on Vero monkey cells showed intermediate
sensitivity.

Publication Types:
In Vitro
Research Support, Non/​U.S. Gov't
Validation Studies

PMID: 11566584 [PubMed /​ indexed for MEDLINE]

257: Planta. 2001 Mar;212(4):535/​46.

Characterisation and high/​resolution distribution of a matrix attachment
region/​binding protein (MFP1) in proliferating cells of onion.

Samaniego R, Yu W, Meier I, Moreno Diaz de la Espina S.

Department of Plant Biology, Centro de Investigaciones Biologicas, CSIC, Madrid,
Spain.

The first matrix attachment region (MAR)/​binding protein sequenced in plants,
MFP1, has been characterised in two dicot species. Based on their antigenic
relationship, we report here the conservation of MFP1/​like proteins in
proliferating root cells of onion (Allium cepa L). Two MFP1/​like proteins with
different molecular masses and solubilities were detected. The most abundant was
a 90/​kDa basic protein, presenting several separate spots in two/​dimensional
blots. The MFP1 was partially soluble and, similar to the proliferating cell
nuclear antigen (PCNA)/​labelled replication factories in the nucleus and nuclear
matrix, was localised at discrete foci as detected by confocal microscopy.
High/​resolution immunolocalisation of MFP1 by electron microscopy identified the
foci as nuclear structures, some of them containing PCNA, which are
ultrastructurally similar to the replication factories described in animal
cells. Our data provide the first report on MFP1/​like proteins in the Alliaceae.
In addition, we present evidence of the presence of AcMFP1 in the putative
replication factories.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11525510 [PubMed /​ indexed for MEDLINE]

258: Plant Cell Physiol. 2001 Aug;42(8):857/​63.

Short/​ and long/​term effects of dehydroascorbate in Lupinus albus and Allium
cepa roots.

Paciolla C, De Tullio MC, Chiappetta A, Innocenti AM, Bitonti MB, Liso R,
Arrigoni O.

Dipartimento di Biologia e Patologia Vegetale, Universita di Bari, via E.
Orabona 4, I/​70125 Bari, Italia.

Administration of 1 mM dehydroascorbate (DHA) results in a rapid and large
increase in cellular ascorbate (AA) content in both Lupinus albus L. and Allium
cepa L. root tips. Uptake of DHA from the medium occurs at a high rate within
10/​12 h of incubation, and is slowed down thereafter. In the first few h, DHA
reduction to AA is apparently correlated to GSH depletion and slightly higher
DHA reductase activity. DHA incubation also seems to induce new GSH synthesis.
Longer DHA incubation (24 h) affects root growth by inhibiting cell
proliferation. At this stage, an apparently generalised oxidation of
SH/​containing proteins is observed in DHA/​treated roots. Treatment with 1 mM
L/​galactono/​gamma/​lactone, the last precursor of AA biosynthesis, results in an
increase in AA content similar to that obtained with DHA, but stimulates growth
and affects the redox state of SH/​containing proteins in the opposite way. A
possible multi/​step mechanism of DHA reduction/removal is suggested and the
hypothesis that DHA inhibits cell cycle progression by affecting the redox state
of SH/​containing proteins is discussed.

PMID: 11522912 [PubMed /​ indexed for MEDLINE]

259: Farmaco. 2001 May/​Jul;56(5/​7):475/​82.

Pharmaco/​toxicological screening of commercially available Italian natural
mineral waters.

Evandri MG, Bolle P.

Department of Pharmacology and Physiology, School of Pharmacy, University of
Rome La Sapienza, Italy.

The consumption of natural mineral water has increased enormously during the
past few years, yet doubts are arising about the real utility of using such
water instead of ordinary drinking water (tap water). Mineral water's 'special'
mineral composition might have properties favourable to health, which should be
assessed by clinical and pharmacological analyses. A comparative
pharmaco/​toxicological study was performed on 14 commercially available Italian
natural mineral waters with a wide range of mineral content. The waters were
microbiologically analysed and the Allium cepa test done; in addition, Irwin,
charcoal meal and diuresis tests were also performed on laboratory animals. No
toxicological signs were recorded at the Allium cepa assay for any but the water
with the highest mineral content. The diuretic effect was comparable to that of
control tap water. Waters with high magnesium content significantly enhanced
intestinal motility while at the Irwin test none of the water samples evoked
behavioural changes. All the tested samples were microbiologically pure. In
conclusion, mineral water can be an alternative to aqueduct water in places
where the latter comes from superficial water and has to be subjected to hard
potabilisation techniques; water from the 'Acqua Marcia' aqueduct (control) was
found to have characteristics comparable to the mineral waters studied.

PMID: 11482782 [PubMed /​ indexed for MEDLINE]

260: Plant Physiol. 2001 Jul;126(3):1129/​38.

An insight into cell elasticity and load/​bearing ability. Measurement and
theory.

Wei C, Lintilhac PM, Tanguay JJ.

Department of Botany, Marsh Life Science Building, University of Vermont,
Burlington, Vermont 05405/​0086, USA. cwei@zoo.uvm.edu

We have studied the elasticity and load bearing ability of plant tissue at the
cellular level, using onion (Allium cepa) epidermal cells. The Young's modulus
and Poisson's ratio of the cells were obtained by loading a tensile force on
onion epidermal peels of different turgor pressures, and measuring the
elongation and the lateral contraction of the peels. The Young's moduli and the
Poisson's ratios ranged from 3.5 to 8.0 MPa and 0.18 to 0.30, respectively. To
determine the effects of cell elasticity and turgor pressure on the cell's
ability to bear load, we loaded a small glass ball onto a cell and measured the
projected contact area between the ball and the cell. Unlike previous studies,
we considered the cell as a whole entity, and utilized the Boussinesq's solution
to derive the relevant equations that related the elastic parameters and cell
deformation. For cells with a turgor pressure > or = 0.34 MPa, the predicted
contact area agreed well with the measured area. The equations could also
predict cell turgor pressure with a deviation from the measured value of 0.01
MPa. This study gives strong support to ball tonometry, a new method of
measuring cell turgor pressure.

PMID: 11457963 [PubMed /​ indexed for MEDLINE]

261: J Agric Food Chem. 2001 Jul;49(7):3216/​22.

Domestic processing of onion bulbs (Allium cepa) and asparagus spears (Asparagus
officinalis): effect on flavonol content and antioxidant status.

Makris DP, Rossiter JT.

Department of Food Quality Management, Mediterranean Agronomic Institute of
Chania, P.O. Box 85, 73100, Chania, Greece. dimitris@maich.gr

Two commonly consumed plant foods, onion bulbs and asparagus spears, were
subjected to typical domestic processing, including chopping, maceration, and
boiling. The impact of these processes on flavonol content was assessed.
Further, the consequences of these processes on the antioxidant capacity of the
tissues were evaluated with the beta/​carotene bleaching method. Chopping
significantly affected rutin content in asparagus, yielding an 18.5% decrease in
60 min; but in onions, quercetin 3,4'/​diglucoside (Q(DG)) and quercetin
4'/​glucoside (Q(MG)) were virtually unaffected by chopping. Boiling for 60 min
had more severe effects, as it caused overall flavonol losses of 20.6 and 43.9%
in onions and asparagus, respectively. Chopping of tissues did not considerably
influence the antioxidant capacity, but boiling did provoke notable changes.

PMID: 11453754 [PubMed /​ indexed for MEDLINE]

262: Chromosome Res. 2001;9(5):357/​75.

Comparative genomic in situ hybridization (cGISH) analysis on plant chromosomes
revealed by labelled Arabidopsis DNA.

Zoller JF, Yang Y, Herrmann RG, Hohmann U.

Botanisches Institut der Ludwig/​Maximilians/​Universitat Munchen, Germany.

A new approach for comparative cytogenetic banding analysis of plant chromosomes
has been established. The comparative GISH (cGISH) technique is universally
applicable to various complex genomes of Monocotyledonae (Triticum aestivum,
Agropyron elongatum, Secale cereale, Hordeum vulgare, Allium cepa, Muscari
armenaticum and Lilium longiflorum) and Dicotyledonae (Vicia faba, Beta
vulgaris, Arabidopsis thaliana). Labelled total genomic DNA of A. thaliana
generates signals at conserved chromosome regions. The nucleolus organizing
regions (NORs) containing the majority of tandemly repeated rDNA sequences,
N/​band regions containing satellite DNA, conserved homologous sequences at
telomeres and additional chromosome/​characteristic markers were detected in
heterologous FISH experiments. Multicolour FISH analysis with repetitive DNA
probes simultaneously revealed the chromosome assignment of 56 cGISH signals in
rye and 61 cGISH signals in barley. Further advantages of this technique are:
(1) the fast and straightforward preparation of the probe; (2) the generation of
signals with high intensity and reproducibility even without signal
amplification; and (3) no requirement of species/​specific sequences suitable for
molecular karyotype analysis. Hybridization can be performed without competitive
DNA. Signal detection without significant background is possible under low
stringency conditions. The universal application of this fast and simple
one/​step fluorescence banding technique for plant cytogenetic and plant genome
evolution is discussed.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11448038 [PubMed /​ indexed for MEDLINE]

263: Transgenic Res. 2001 Jun;10(3):237/​45.

Molecular characterization of transgenic shallots (Allium cepa L.) by adaptor
ligation PCR (AL/​PCR) and sequencing of genomic DNA flanking T/​DNA borders.

Zheng SJ, Henken B, Sofiari E, Jacobsen E, Krens FA, Kik C.

Plant Research International, Wageningen University and Research Center, The
Netherlands.

Genomic DNA blot hybridization is traditionally used to demonstrate that, via
genetic transformation, foreign genes are integrated into host genomes. However,
in large genome species, such as Allium cepa L., the use of genomic DNA blot
hybridization is pushed towards its limits, because a considerable quantity of
DNA is needed to obtain enough genome copies for a clear hybridization pattern.
Furthermore, genomic DNA blot hybridization is a time/​consuming method. Adaptor
ligation PCR (AL/​PCR) of genomic DNA flanking T/​DNA borders does not have these
drawbacks and seems to be an adequate alternative to genomic DNA blot
hybridization. Using AL/​PCR we proved that T/​DNA was integrated into the A. cepa
genome of three transgenic lines transformed with Agrobacterium tumefaciens EHA
105 (pCAMBIA 1301). The AL/​PCR patterns obtained were specific and reproducible
for a given transgenic line. The results showed that T/​DNA integration took
place and gave insight in the number of T/​DNA copies present. Comparison of
AL/​PCR and previously obtained genomic DNA blot hybridization results pointed
towards complex T/​DNA integration patterns in some of the transgenic plants.
After cloning and sequencing the AL/​PCR products, the junctions between plant
genomic DNA and the T/​DNA insert could be analysed in great detail. For example
it was shown that upon T/​DNA integration a 66 bp genomic sequence was deleted,
and no filler DNA was inserted. Primers located within the left and right
flanking genomic DNA in transgenic shallot plants were used to recover the
target site of T/​DNA integration.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11437280 [PubMed /​ indexed for MEDLINE]

264: J Exp Bot. 2001 May;52(358):1129/​33.

Water stress can induce quiescence in newly/​germinated onion (Allium cepa L.)
seedlings.

Whalley WR, Lipiec J, Finch/​Savage WE, Cope RE, Clark LJ, Rowse HR.

Silsoe Research Institute, Wrest Park, Silsoe, Bedford MK45 4HS, UK.
richard.whalley@bbsrc.ac.uk

The effect of water stress on the early seedling growth of onions was studied by
placing newly/​germinated seedlings in vermiculite equilibrated at different
water potentials. Roots and shoots elongated more at /​0.29 than at /​0.64 MPa,
but did not elongate at /​1.66 MPa. However, roots and shoots of seedlings that
had been incubated in vermiculite at /​1.66 MPa for up to 35 d resumed elongation
when subsequently placed on wet filter boards. This suggests that water stress
can induce quiescence in newly/​germinated seedlings.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11432930 [PubMed /​ indexed for MEDLINE]

265: J Exp Bot. 2001 May;52(358):1051/​61.

Frequencies of plasmodesmata in Allium cepa L. roots: implications for solute
transport pathways.

Ma F, Peterson CA.

Department of Biology, University of Waterloo, Waterloo, Ontario N2L 3G1,
Canada.

Plasmodesmatal frequencies (PFs) were analysed in Allium cepa L. roots with a
mature exodermis (100 mm from the tip). For all interfaces within the root, the
numbers of plasmodesmata (PD) microm(/​2) wall surface (Fw) were calculated from
measurements of 60 walls on ultrathin sections. For tissues ranging from the
epidermis up to the stelar parenchyma, the frequencies were also expressed as
total PD numbers mm(/​1) root length (Fn), which is most instructive for
considering the radial transport of ions and photosynthates (because the tissues
were arranged in concentric cylinders). The Fn values were constantly high at
the interfaces of exodermis/​central cortex, central cortex/​endodermis and
endodermis/​pericycle (4.05x10(5), 5.13x10(5), and 5.64x10(5), respectively). If
the plasmodesmata are functional, a considerable symplastic transport pathway
exists between the exodermis and pericycle. Two interfaces had especially low
PFs: epidermis/​exodermis (Fn=8.96x10(4)) and pericycle/​stelar parenchyma
(Fn=6.44x10(4)). This suggests that there is significant membrane transport
across the interface of epidermis/​exodermis (through short cells) and direct
transfer of ions from pericycle to protoxylem vessels. In the phloem, the
highest PF was detected at the metaphloem sieve element/​companion cell interface
(Fw=0.42), and all other interfaces had much lower PFs (around 0.10). In the
pericycle, the radial walls had a high PF (Fw=0.75), a feature that could permit
lateral circulation of solutes, thus facilitating ion (inward) and photosynthate
(outward) delivery.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11432921 [PubMed /​ indexed for MEDLINE]

266: Mol Genet Genomics. 2001 May;265(3):543/​51.

Genetic analyses of correlated solids, flavor, and health/​enhancing traits in
onion (Allium cepa L.).

Galmarini CR, Goldman IL, Havey MJ.

EEA La Consulta INTA, Mendoza, Argentina.

Onion possesses organosulfur compounds and carbohydrates that provide unique
flavor and health/​enhancing characteristics. Significant phenotypic correlations
have been reported among soluble solids content (SSC), total dry matter,
pungency, and onion/​induced in vitro antiplatelet activity. A genetic map and
segregating F3M families derived from a cross between two inbred populations
were used to identify and estimate the effects of quantitative trait loci (QTLs)
controlling these traits at 30 and 90 days postharvest. In vitro antiplatelet
activities among different onion populations were consistent across six human
blood donors. Most of the populations showed in vitro antiplatelet activities;
however, for some donors, one of the parental lines and two F3M families had
pro/​aggregatory effects under our experimental conditions. SSC, dry matter,
pungency, and in vitro antiplatelet activity showed significant positive
phenotypic and genetic correlations. A chromosome region on linkage group E
accounted for a significant amount of the phenotypic variation for all of these
traits. The correlations among these traits may be due to linkage or pleiotropy
of genes controlling solids content. Our results indicate that it will be
difficult to develop onion populations with lower pungency and high in vitro
antiplatelet activity; however, the strong genetic and phenotypic correlations
between high in vitro antiplatelet activity and high SSC are beneficial for the
health functionality of onion.

Publication Types:
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 11405638 [PubMed /​ indexed for MEDLINE]

267: Phytochemistry. 2001 Jul;57(5):661/​8.

Structure of fructans from excised leaves of New Zealand flax.

Sims IM, Cairns AJ, Furneaux RH.

Industrial Research Limited, PO Box 31/​310, Lower Hutt, New Zealand.
i.sims@irl.cri.nz

The accumulation of total water/​soluble carbohydrate, and specifically sucrose
and fructan, by excised leaves of Phormium tenax and P. cookianum (family
Phormiaceae J. G. Agardh, order Asparagales) was investigated. Total
water/​soluble carbohydrate content of excised leaves of P. tenax and P.
cookianum increased during 48 h of continuous illumination at an average rate of
1.3 and 0.9 mg g(/​1) fresh weight leaf per hour, respectively. The sucrose
content of excised leaves increased throughout the experimental period. The
fructan content of excised leaves of P. tenax increased slightly throughout the
experimental period, whilst that of P. cookianum was variable and showed no
overall change. Chemical and spectroscopic analysis of the fructans obtained
from the two Phormium species showed that they were similar to each other and
contained mostly 1/​linked and terminal fructofuranosyl (Fruf) residues, together
with smaller amounts of 6/​linked Fruf, 1,6/​branched Fruf, terminal and 6/​linked
glucopyranosyl residues. Separation of the fructans by thin/​layer and
high/​performance anion/​exchange chromatography revealed the presence of a
complex mixture of fructo/​oligosaccharides and higher molecular weight fructan.
The branched structure of the fructans isolated from excised leaves of Phormium
resembles that of fructans and fructo/​oligosaccharides isolated from some
related species within the order Asparagales (Agave vera cruz, Cordyline
australis and Urginea maritima), but is distinct from the linear structure of
fructans from others (Allium cepa and Asparagus officinalis). The structural
heterogeniety of fructans within both the order Asparagales and superorder
Liliiflorae may be a useful chemotaxonomic aid.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11397431 [PubMed /​ indexed for MEDLINE]

268: Biocell. 2001 Apr;25(1):29/​34.

The sesquiterpene lactone dehydroleucodine reversibly inhibits Allium cepa L.
root growth.

Sartor T, Elis Lopez M, Gutierrez L, Guerreiro E, Giordano OS, Lopez LA.

Instituto de Histologia y Embriologia, Facultad de Ciencias Medicas U.N. Cuyo
Mendoza Argentina.

Here, we prove that dehydroleucodine, a sesquiterpene lactone, at low
concentrations (25/​100 microM) slowed down the Allium cepa L root growth by
22/​70% respectively neither affecting cell viability nor cell size. Removal of
the drug after 24 h incubation restored the normal growth rate of the roots.
Higher concentrations (200 microM) of dehydroleucodine were deleterious for the
roots. As cell size did not change, it is most likely that dehydroleucodine
affected some event of cell division cycle making it longer. Thus,
dehydroleucodine could be a useful tool to slow down cell proliferation.

PMID: 11387874 [PubMed /​ indexed for MEDLINE]

269: Genes Genet Syst. 2001 Feb;76(1):53/​60.

Identification and chromosomal location of tandemly repeated DNA sequences in
Allium cepa.

Do GS, Seo BB, Yamamoto M, Suzuki G, Mukai Y.

Department of Biology, Kyungpook National University, Taegu, Korea.

A 314/​bp tandemly repeated DNA sequence, named pAc074, was characterized in
Allium cepa by fluorescence in situ hybridization (FISH) analyses using random
amplified fragment as probe. The nucleotide sequences of the clone pAc074 is
partially homologous to the satellite DNA sequences, ACSAT1, ACSAT2, and ACSAT3,
of A. cepa with 81%, 81% and 78% similarity, respectively. Our sequential
C/​banding and FISH with pAc074 probe also clearly showed a close relation
between Cheterochromatin at telomeric region and pAc074 sequences on all the
chromosomes except on chromosome 6. On the long arm of chromosome 7, pAc074
sequences appeared as interstitial band which did not correspond to
C/​heterochromatin bands. Instead, the C/​heterochromatin bands corresponded with
the 5S rDNA signals. This is the first evidence of simultaneous banding of the
5S rDNA and C/​band in A. cepa.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11376552 [PubMed /​ indexed for MEDLINE]

270: Yao Xue Xue Bao. 2000 Oct;35(10):752/​5.

[A new flavonoid glycoside from Allium cepa L. var agrogatum Don]

[Article in Chinese]

Yang XH, Liu YY, Liu LJ, Zhou XP, Toshio S.

Department of Medicinal Chemistry, College of Pharmaceutical Science, Norman
Bethune University of Medical Sciences, Changchun 130021, China.
yang.xh.cc.jl.cn@263.net

AIM: To investigate the chemical constituents from the bulb stems of the Chinese
medicinal plant Allium cepa L. var. agrogatum Don. METHODS: The crude extracts
of the bulb stem were purified by Sephadex LH/​20 chromatography. IR, UV, MS, 1H,
13CNMR, 1H/​1H COSY, 1H/​13C COSY and HMBC spectra were used to determine the
structure of the isolated constituents. RESULTS: A new compound named quercetin
3'/​methoxy/​4'/​O/​beta/​D/​glucopyranoside(I), together with three known compounds
kaempferol(II), quercetin 4'/​O/​beta/​D/​glucopyranoside(III) and quercetin
3,4'/​di/​O/​beta/​D/​glucopyranoside(IV) were isolated. CONCLUSION: Quercetin
3'/​methoxy/​4'/​O/​beta/​D/​glucopyranoside(I) is a new compound, compounds II/​IV
were isolated from this plant for the first time.

Publication Types:
English Abstract
Research Support, Non/​U.S. Gov't

PMID: 11372441 [PubMed /​ indexed for MEDLINE]

271: Indian J Exp Biol. 2001 Jan;39(1):57/​62.

Evaluation of phytotoxicity and genotoxicity of uranyl nitrate in Allium assay
system.

Panda BB, Panda KK, Patra J, Sahu GK, Mitra RK.

Genecology and Tissue Culture Laboratory, Department of Botany, Berhampur
University, Berhampur 760 007, India. brahma 1@dte.vsnl.net in

Uranyl nitrate inhibited root growth of Allium cepa at > or = 25 microM
concentration. Fluorimetric analysis of metal uptake indicated the entry and
accumulation of uranium into the root cell. Uranyl nitrate was neither
clastogenic nor aneugenic as it failed to induce micronuclei significantly, but
between 25 and 100 microM concentration, it increased significantly the
frequency of sister chromatid exchange over that of control, implying its
genotoxicity that possibly interfered with DNA replication and/or repair
process.

Publication Types:
Evaluation Studies

PMID: 11349527 [PubMed /​ indexed for MEDLINE]

272: Environ Toxicol. 2001;16(2):113/​6.

Evaluation of the genotoxic potential of municipal waste water discharged into
the Paraguay River during periods of flood and drought.

de Lima Moraes DS, Jordao BQ.

Department of Sciences of the Environment, University Centre of Corumba, Federal
University of South Mato Grosso, Brazil.

The cytogenotoxic effects of the waste water from Corumba and of the water of
the Paraguay River, where this sewer discharges, were evaluated in flood and
drought seasons. Allium cepa root meristems were exposed to 20 and 72 h
treatments. Mitotic index, frequency, and types of aberrant cells were compared
to the control. The waste water was genotoxic to this organism. The cycle of
flood and drought influenced the levels of genotoxicity observed with the river
water.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11339709 [PubMed /​ indexed for MEDLINE]

273: Plant J. 2001 Mar;25(6):699/​707.

Localization of single/​copy T/​DNA insertion in transgenic shallots (Allium cepa)
by using ultra/​sensitive FISH with tyramide signal amplification.

Khrustaleva LI, Kik C.

Plant Research International, Wageningen University and Research Center, PO Box
16, 6700 AA Wageningen, The Netherlands.

The sensitivity of fluorescence in situ hybridization (FISH) for mapping plant
chromosomes of single/​copy DNA sequences is limited. We have adapted for plant
cytogenetics a new signal/​amplification method termed tyramide/​FISH (Tyr/​FISH).
Until present this technique has only been applied to human chromosomes. The
method is based on enzymatic deposition of fluorochrome/​conjugated tyramide.
With Tyr/​FISH it was possible to detect target T/​DNA sequences on plant
metaphase chromosomes as small as 710 bp without using a cooled CCD camera.
Short detection time and high sensitivity, in combination with a low background,
make the Tyr/​FISH method very suitable for routine application in plant
cytogenetic research. With Tyr/​FISH we analysed the position of T/​DNA inserts in
transgenic shallots. We found that the inserts were preferentially located in
the distal region of metaphase chromosomes. Sequential fluorescence in situ
hybridization with a 375 bp satellite sequence suggested that a specific T/​DNA
insert was located within the satellite sequence hybridization region on a
metaphase chromosome. Analysis of less/​condensed prophase and interphase
chromosomes revealed that the T/​DNA was integrated outside the satellite
DNA/​hybridization region in a more proximal euchromatin region.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11319036 [PubMed /​ indexed for MEDLINE]

274: J Agric Food Chem. 2001 Mar;49(3):1652/​7.

Aquatic humic substances inhibit clastogenic events in germinating seeds of
herbaceous plants.

Ferrara G, Loffredo E, Senesi N.

Dipartimento di Biologia e Chimica Agroforestale ed Ambientale, University of
Bari, Via Amendola 165/A, 70126 Bari, Italy.

One humic acid (HA) and two fulvic acids (FAs) of aquatic origin have been
tested for their capacity to inhibit clastogenic events caused by maleic
hydrazide (MH) in germinating seeds of the herbaceous plant species Allium cepa
and Vicia faba. Either HA or FA at concentrations of 50 and 500 mg L(/​)(1) was
interacted with 10 mg L(/​)(1) MH for 24 h before addition to the seeds. The
evaluation of genotoxic activity was made by counting micronuclei (MN) and
aberrant anatelophases (AT) in root tip cells after treatment with HA or FA
alone, MH alone, and interacted HA + MH and FA + MH. Regular AT were also
counted as an index of mitotic activity. In all cases HA and FA interacted with
MH showed an evident anticlastogenic action indicated by the marked reduction of
genetic anomalies. In A. cepa, the anticlastogenic effect of HA and FA was more
significant for aberrant AT than for MN, whereas the opposite was true in the
case of V. faba. The protective effect exhibited for both anomalies by HA was
slightly higher than that of the corresponding FA in A. cepa, whereas no
significant differences between these HA and FA treatments were observed in the
case of V. faba. The two FAs generally showed similar anticlastogenic behaviors
with slight quantitative differences observed as a function of the type of
anomaly and the plant species. The effects of HA and FA concentration differed
depending on the type of anomaly observed, the plant species, and FA origin. In
V. faba, cell division, that is, the number of regular AT, was generally
depressed by HA and FA at either concentration with respect to the control. In
A. cepa, HA and FA produced either stimulating or inhibiting effects on regular
AT depending on their nature, origin, and concentration.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11312910 [PubMed /​ indexed for MEDLINE]

275: J Agric Food Chem. 2000 Dec;48(12):6094/​102.

Comparative investigation of concentrations of major and trace elements in
organic and conventional Danish agricultural crops. 1. Onions (Allium cepa
Hysam) and peas (Pisum sativum ping pong).

Gundersen V, Bechmann IE, Behrens A, Sturup S.

Plant Biology and Biogeochemistry Department, Riso National Laboratory, PBK/​124,
P.O. Box 49, DK/​4000 Roskilde, Denmark. vagn.gundersen@risoe.dk

210 samples of onions (Allium cepa Hysam) from 11 conventionally and 10
organically cultivated sites and 190 samples of peas (Pisum sativum Ping Pong)
from 10 conventionally and 9 organically cultivated sites in Denmark were
collected and analyzed for 63 and 55 major and trace elements, respectively, by
high/​resolution inductively coupled plasma mass spectrometry. Sampling, sample
preparation, and analysis of the samples were performed under carefully
controlled contamination/​free conditions. Comparative statistical tests of the
element concentration mean values for each site show significantly (p < 0.05)
different levels of Ca, Mg, B, Bi, Dy, Eu, Gd, Lu, Rb, Sb, Se, Sr, Ti, U, and Y
between the organically and conventionally grown onions and significantly (p <
0.05) different levels of P, Gd, and Ti between the organically and
conventionally grown peas. Principal component analysis (PCA) applied to the 63
elements measured in the individual onion samples from the 21 sites split up the
sites into two groups according to the cultivation method when the scores of the
first and third principal components were plotted against each other.
Correspondingly, for peas, a PCA applied to the 55 elements measured as mean
values for each site split up the 19 sites into two groups according to the
cultivation method when the scores of the third and fourth principal component
were plotted against each other. The methodology may be used as authenticity
control for organic cultivation after further method development.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 11312781 [PubMed /​ indexed for MEDLINE]

276: Cell Res. 2001 Mar;11(1):68/​73.

Structural components of the nuclear body in nuclei of Allium cepa cells.

Tao W, Yan CH, Cai T, Hao S, Zhai ZH.

College of Life Sciences, Peking University, Beijing, China.

Nuclear bodies have long been noted in interphase nuclei of plant cells, but
their structural component, origin and function are still unclear by now. The
present work showed in onion cells the nuclear bodies appeared as a spherical
structure about 0.3 to 0.8 microm in diameter. They possibly were formed in
nucleolus and subsequently released, and entered into nucleoplasm. Observation
through cytochemical staining method at the ultrastructural level confirmed that
nuclear bodies consisted of ribonucleoproteins (RNPs) and silver/​stainable
proteins. Immunocytochemical results revealed that nuclear bodies contained no
DNA and ribosomal gene transcription factor (UBF). Based on these data, we
suggested that nuclear bodies are not related to the ribosome or other gene
transcription activities, instead they may act as subnuclear structures for RNPs
transport from nucleolus to cytoplasm, and may also be involved in splicing of
pre/​mRNAs.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11305327 [PubMed /​ indexed for MEDLINE]

277: Z Naturforsch [C]. 2001 Jan/​Feb;56(1/​2):45/​8.

Cytotoxic triterpenoids from Erica andevalensis.

Martin/​Cordero C, Reyes M, Ayuso MJ, Toro MV.

Departamento de Farmacologia, Facultad de Farmacia, Sevilla, Espana.

The cytotoxic activity of two pentacyclic triterpenoids (ursolic acid and
alpha/​amyrine) isolated from the methanolic extract of the aerial parts from
Erica andevalensis, whose structures have been established on the basis of
spectroscopic and chemical evidence, has been assessed against three human
cancer cell lines, TK/​10 (renal adenocarcinoma), MCF/​7 (breast adenocarcinoma)
and UACC/​62 (melanoma), recommended by NCI (National Cancer Institute) and we
also evaluated the antimitotic effect in root meristematic cells of Allium cepa.
Ursolic acid was found to possess the highest cytotoxic activity.

PMID: 11302212 [PubMed /​ indexed for MEDLINE]

278: Planta. 2001 Feb;212(3):444/​53.

Replication and G2 checkpoints: their response to caffeine.

Pelayo HR, Lastres P, De la Torre C.

Centro de Investigaciones Biologicas, CSIC, Velazquez, Madrid, Spain.

Under long hydroxyurea treatments, evidence was obtained for the sequential
activation of four checkpoints located between the onset of S phase and mitosis
in Allium cepa L. root meristems. Biparametric flow cytometry (Br/​DNA/total DNA)
showed that cells initially accumulated at early S phase but, after a delay,
they resumed replication and paused again at mid S phase. Cells not only
overrode this second replication block but also any G2 checkpoint they
encountered. Thus, a late mitotic wave was produced in the presence of
hydroxyurea. The wave was formed by cells that had apparently completed their
replication (normal mitoses), while others displayed anaphases/telophases with
less than the expected DNA content and with chromosomal breaks (aberrant
mitoses). The presence of aberrant mitoses is direct evidence for the undue
override of the two G2 checkpoints responsible for surveillance of completion of
DNA synthesis and repair, respectively. Caffeine selectively abrogated the G2
block produced by the checkpoint that controls post/​replication DNA repair, as
it advanced the entry of cells into an aberrant mitosis. However, caffeine
proved not to be the universal checkpoint/​evading agent as postulated. Caffeine
did not modify the spontaneous override of the replication checkpoints.
Moreover, it seems to enforce the checkpoint that controls the completion of DNA
synthesis, as the appearance of the late wave of normal mitoses produced in the
presence of hydroxyurea was prevented by the use of caffeine.

Publication Types:
In Vitro
Research Support, Non/​U.S. Gov't

PMID: 11289610 [PubMed /​ indexed for MEDLINE]

279: Food Addit Contam. 2000 Dec;17(12):1037/​45.

Toxicological evaluation of commercial mineral water bottled in polyethylene
terephthalate: a cytogenetic approach with Allium cepa.

Evandri MG, Tucci P, Bolle P.

Dipartimento di Farmacologia delle Sostanze Naturali e Fisiologia Generale,
University of Rome La Sapienza P. le Aldo Moro, 5/​00185 Rome, Italy.

The aim of this study was to ascertain the possible toxicological effects of
chemicals released into mineral water packaged in polyethylene terephthalate
(PET) bottles. Two commercial mineral waters, bottled both in PET and glass and
stored under different conditions, were examined using the Allium cepa test. The
influence of the water samples on macroscopic (root length, colour and form) and
microscopic (root tip mitotic index, chromosome aberrations) parameters was
examined. The water samples were analysed after: (A) controlled/​condition
storage (no direct light exposure and 18 +//​ 2 degrees C), (B) storage at 40
degrees C for 10 days, in the dark (migration test in accordance with
82/711/EEC), and (C) exposure to sunlight and varying temperatures (18/​38
degrees C, mean temperature 25 +//​ 3 degrees C). The two water samples bottled
in PET induced cytogenetic aberrations regardless of the storage conditions.
These signs of toxicity were evident even only 8 weeks after bottling, which is
well within the recommended expiry date. Storage conditions were very important,
as is suggested by the finding that chromosomal aberrations were particularly
apparent after exposure to direct sunlight. However, as plant systems are not
considered as primary screening tools by current international guidelines for
mammalian systems, extrapolation of the results from this test system to other
systems and, eventually, to human beings should be based on results from a
battery of assays covering various metabolic pathways.

PMID: 11271838 [PubMed /​ indexed for MEDLINE]

280: Phytother Res. 2001 Mar;15(2):109/​13.

Augmentation of natural killer cell activity in vivo against tumour cells by
some wild plants from Jordan.

Abuharfeil NM, Salim M, Von Kleist S.

Department of Applied Biology, Jordan University of Science and Technology,
Irbid, Jordan. harfeil@just.edu.jo

Twelve aqueous extracts prepared from Jordanian plants that are currently used
in traditional medicine to treat various types of cancer were tested in mice for
their augmentation of natural killer cells in vivo in generating cytotoxicity
against YAC tumour targets. After 1 week of oral administration of aqueous
extracts of fresh Nigella sativum (N.s.) seeds and Allium sativum (A.s.) bulbs
significant augmentation of splenic natural killer (NK) cells (62.3% +//​ 6.4%
and 52.6% +//​5.4% cytotoxicity, respectively), was obtained in comparison with
spontaneous activity (24.5% +//​ 1.6%) at 200:1 effector:target ratio. Onopordum
acanthium (O.a.) stem and leaves and Allium cepa (A.c.) bulbs showed
intermediate augmentation (38.6% +//​ 3.8% and 30.6% +//​ 3.4% cytotoxicity,
respectively) while the rest showed insignificant augmentation activity. The
fresh aqueous extract of a mixture of the plants with high and intermediate
activity showed little insignificant augmentation activity (72.7% +//​ 6.7%
cytotoxicity) of NK cells compared with that obtained with each plant alone.
Copyright 2001 John Wiley & Sons, Ltd.

PMID: 11268107 [PubMed /​ indexed for MEDLINE]

281: J Agric Food Chem. 2001 Feb;49(2):982/​8.

Effect of storage on fructan and fructooligosaccharide of onion (Allium cepa
L.).

Jaime L, Martin/​Cabrejas MA, Molla E, Lopez/​Andreu FJ, Esteban RM.

Departamento de Quimica Agricola, Facultad de Ciencias, Universidad Autonoma de
Madrid (UAM), 28049 Madrid, Spain.

The purpose of this study was a comparative examination of the fructan and
fructooligosaccharide (FOS) content of different varieties of onions (Allium
cepa L. cv. Sturon, Hysam, Durco, Grano de Oro, and Caribo) and the changes
produced during their commercial storage. In fresh onions, the Grano de Oro
variety presented a remarkably different behavior, showing low contents of total
fructans and FOS and high levels of reducing sugars. In the other varieties,
Sturon, Hysam, Durco, and Caribo, fructans were the main carbohydrates, the
lowest polymerized FOS being the major oligomer. Storage period caused in these
varieties important increased levels of free fructose attributed to fructan
hydrolysis. Maleic hydrazide treatment had no significant effect in avoiding the
hydrolysis of fructans during storage conditions for the Sturon variety.
Varieties with >16% dry matter or 15% soluble solids contents could be stored
for 6 months at 0 degrees C and 60/​65% relative humidity.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 11262060 [PubMed /​ indexed for MEDLINE]

282: Yi Chuan Xue Bao. 2000;27(10):896/​901.

[ScII/​like protein is localized in the nuclei, chromosomes and chromosome
scaffolds of Allium cepa]

[Article in Chinese]

Wang Y, Xing M, Yan S.

Institute of Genetics and Cytology, Northeast Normal University, Chang chun
130024, China. Shenzhen University, Shenzhen 518060, China.

The nuclei were isolated from the root meristematic cells of Allium cepa and the
nuclear matrices were prepared. A 135 kD polypeptide, which is equivalent to Sc
II in molecular weight, was revealed in the nuclei by SDS/​PAGE and was then
demonstrated to be an Sc II/​like protein by Western blot with an anti/​chicken Sc
II antiserum. Neither the 135 kD polypeptide nor the positive labelling of the
anti/​Sc II antiserum was found in the nuclear matrices. The immuno/​fluorescence
tests showed that the nuclei labelled with the anti/​Sc II antiserum emanated
strong, specific fluorescence, while the fluorescence of the nuclear matrices
was too weak to be detected. The results of immunoelectron microscopy indicated
that a large number of the gold particles were concentrated in the condensed
chromatin of the nuclei, but very few gold particles were distributed in
cytoplasm and nucleoplasm. These results strongly suggested that an Sc II like
protein is a component of the nuclei of A. cepa and is mainly located in the
condensed chromatin regions, but the nuclear matrices contain no or very little
amount of that protein. By means of immunofluorescence and immunoelectron
microscopy, the chromosomes and chromosomal scaffolds of A. cepa labelled with
the anti/​chicken Sc II antiserum were observed to send off specific fluorescence
and have many gold particles representing the presence of the Sc II/​like protein
distributed among them. The significance of the Sc II/​like protein as a novel
component in the nuclei, chromosomes and chromosome scaffolds of higher plants
is discussed.

Publication Types:
English Abstract
Research Support, Non/​U.S. Gov't

PMID: 11192434 [PubMed /​ indexed for MEDLINE]

283: Folia Histochem Cytobiol. 2000;38(4):181/​4.

Different rRNA gene expression in primary and adventitious roots of Allium cepa
L.

Hasterok R, Maluszynska J.

Department of Plant Anatomy and Cytology, Silesian University, Katowice, Poland.

Sequentially used silver staining and in situ hybridization allowed to estimate
the number of rDNA loci and their activity in meristematic cells of Allium cepa
roots. In primary roots, obtained from germinated seeds, the rDNA probe
hybridized with four chromosomes and showed four strong sites of hybridization.
All of them displayed very clear positive silver staining. In cells of
adventitious roots, from bulbs, only one pair of rRNA gene loci was active and
after in situ hybridization showed strong signals while two other sites were
very weak. The results indicate different transcriptional rRNA gene activity in
meristematic cells of roots of different developmental origin. The reduction of
the number of active rRNA loci can be the result of DNA methylation but the
reduction mechanism of in situ hybridization sites in adventitious roots of
Allium cepa remains an open question.

PMID: 11185723 [PubMed /​ indexed for MEDLINE]

284: Br J Nutr. 2000 Dec;84(6):919/​25.

Effect of dietary quercetin on oxidative DNA damage in healthy human subjects.

Beatty ER, O'Reilly JD, England TG, McAnlis GT, Young IS, Geissler CA, Sanders
TA, Wiseman H.

Nutrition, Food & Health Research Centre, Department of Nutrition and Dietetics,
King's College London, Franklin/​Wilkins Building, 150 Stamford Street, London
SE1 8WA, UK.

The effect of dietary intake of flavonols (predominantly quercetin) on oxidative
DNA damage was studied in thirty/​six healthy human subjects (sixteen men, twenty
women). The study was a randomised crossover study, comprising two 14 d
treatments of either a low/​flavonol (LF) or high/​flavonol (HF) diet with a 14 d
wash/​out period between treatments. Subjects were asked to avoid foods
containing flavonols, flavones and flavanols during the LF dietary treatment
period and to consume one 150 g onion (Allium cepa) cake (containing 89.7 mg
quercetin) and one 300 ml cup of black tea (containing 1.4 mg quercetin) daily
during the HF dietary treatment. A 7 d food diary was kept during each dietary
period and blood samples were taken after each dietary treatment. Products of
oxidative damage to DNA bases were measured in DNA from leucocytes. The study
had more than 95% power to detect a change of 20% in DNA damage products Plasma
vitamin C and plasma quercetin concentrations were also measured. No significant
differences in intake of macronutrients or assessed micronutrients, measured DNA
base damage products, or plasma vitamin C were found between the HF and LF
dietary treatments. The plasma quercetin concentration was significantly higher
after the HF dietary treatment period (228.5 (SEM 34.7) nmol/l) than after the
LF dietary treatment period (less than the limit of detection, i.e. <66.2
nmol/l). These findings do not support the hypothesis that dietary quercetin
intake substantially affects oxidative DNA damage in leucocytes.

Publication Types:
Clinical Trial
Randomized Controlled Trial
Research Support, Non/​U.S. Gov't

PMID: 11177210 [PubMed /​ indexed for MEDLINE]

285: Environ Exp Bot. 2001 Feb;45(1):85/​94.

Diversity of cell lengths in terminal portions of roots: location of the
proliferative cell population.

Evans LS, Lagrazon K, Pancrudo J.

Laboratory of Plant Morphogenesis, Biological Sciences Research Laboratories,
Manhattan College, 10471, The Bronx, NY, USA

Terminal meristems are responsible for all primary growth of roots. It has been
asserted that all cells of root meristems are actively dividing and that the
stem cell (proliferative) population expands exponentially. Lengths of cells in
roots just proximal to the root cap/root initial boundary were used to determine
the numbers of cortex and stele cells in the meristem. Meristem cells were
defined as cells that did not have significantly different cell lengths from
initial cells at the boundary. Data show that, for five of the six species
(Allium cepa, Pisum sativum, Pyrus communis, Triticum aestivum, Vicia faba, and
Zea mays) tested, only the first 15 stele and the first 10/​35 cortex cells in
median longitudinal sections would be in the meristem. For T. aestivum, no
discrete meristem was found because all cells proximal to initial cells were
longer than initial cells. In addition to this subject area, distributions of
lengths of cells in the root meristem using this definition, for the six species
were compared with a theoretical cell/​age distribution for exponentially
dividing cells, to determine if distributions of cell lengths were similar to a
theoretical distribution of exponentially dividing cells. For all species
tested, distributions of cell lengths were not similar to a theoretical cell/​age
distribution. From the data of this study with six plant species, we conclude
that either contiguous proliferative cell populations of root meristems are very
small or the proliferative cell population is not continuous. In addition, such
populations do not resemble a theoretical exponential cell/​age distribution.
Moreover, it seems that the proliferative capacities of cells within terminal
root segments differ markedly among species and are not easily characterized.

PMID: 11165634 [PubMed /​ as supplied by publisher]

286: J Agric Food Chem. 2000 Nov;48(11):5612/​7.

Physicochemical characteristics of onion (Allium cepa L.) tissues.

Ng A, Parker ML, Parr AJ, Saunders PK, Smith AC, Waldron KW.

Institute of Food Research, Norwich Research Park, Colney, Norwich NR4 7UA,
United Kingdom.

The structure and mechanical properties of onions are important factors
affecting their textural quality. The onion bulb consists of several layers of
pigmented, papery scales surrounding fleshy storage scales that comprise an
upper epidermis, an intermediate parenchyma tissue, and a lower epidermis. The
purpose of this study was to examine the chemical composition of cell walls from
the papery scales and outer fleshy scales of onion (Allium cepa L. cv. Sturon)
in relation to their mechanical properties. Cell/​wall material (CWM) was
prepared from the component tissues and analyzed for its carbohydrate and
phenolic composition. The CWMs were rich in uronic acid and glucose, with
smaller quantities of arabinose, galactose, and xylose. In the fleshy scales,
the lower epidermis contained relatively more galactose/​rich pectic
polysaccharides, whereas the upper epidermis and the papery scales contained
virtually no galactose. Analysis of mechanical properties showed that the order
of strength of the tissues was papery scales > fleshy scales, which were in the
order lower epidermis > upper epidermis > intermediate parenchyma. The upper
epidermis of fleshy scales was stronger in the vertical than the horizontal
direction, and both orientations showed negligible notch sensitivity.
Cyclohexane/​trans/​1,2/​diaminetetraacetate/​induced vortex/​induced cell separation
of the intermediate layer of fleshy scales indicated that calcium cross/​linking
may play an important role in cell/​cell adhesion. A small but significant amount
of ferulic acid was found in the walls, predominantly in the thick cuticle of
the lower epidermis of fleshy scales. Alkali/​labile wall/​bound flavonoids were
also detected.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 11087527 [PubMed /​ indexed for MEDLINE]

287: Chemosphere. 2000 Nov;41(10):1519/​27.

The cytotoxic effect of wastewater from the phosphoric gypsum depot on common
oak (Quercus robur L.) and shallot (Allium cepa var. ascalonicum).

Pavlica M, Besendorfer V, Rosa J, Papes D.

Department of Molecular Biology, Faculty of Science, University of Zagreb,
Croatia. mpavlica@zg.biol.pmf.hr

The effect of wastewater from a phosphoric gypsum depot on common oak, Quercus
robur L., at cytogenetical level was studied. Allium/​test was used as a control.
The treatment of common oak seedlings with wastewater under laboratory
conditions caused mitodepressive effect. Chromosome aberrations and mitotic
irregularities were found. Cytogenetic analysis of common oak seedlings grown
from acorns collected near the depot did not show changes in mitotic activity in
comparison to control but the number of aberrations was higher than in control.
In comparison to Alliumtest common oak was found to be more tolerant to
wastewater from the phosphoric gypsum depot.

PMID: 11057676 [PubMed /​ indexed for MEDLINE]

288: Pharmazie. 2000 Sep;55(9):702/​3.

Effect of liquid extract from fresh Abutilon indicum leaves and Allium cepa
bulbs on paracetamol and carbontetrachloride induced hepatotoxicity.

Porchezhian E, Ansari SH.

Department of Pharmacognosy and Phytochemistry, Faculty of Pharmacy, Jamia
Hamdard (Hamdard University), New Delhi, India.

PMID: 11031781 [PubMed /​ indexed for MEDLINE]

289: J Ethnopharmacol. 2000 Nov;73(1/​2):221/​32.

Ethnobotanical survey in the Palestinian area: a classification of the healing
potential of medicinal plants.

Ali/​Shtayeh MS, Yaniv Z, Mahajna J.

Department of Biological Sciences, Faculty of Science, An/​Najah National
University, P.O. Box 696, Palestine, West Bank, Nablus, Israel.
shtayeh@zaytona.com

An ethnobotanical survey was carried out in the West Bank to evaluate the
relative efficacy of the plants used to treat skin diseases and prostate cancer.
A total number of 102 informants, 30 years and older and either native born or
had been living in the West Bank for more than 30 years, were interviewed using
a previously prepared questionnaire. Of about 165 plant species mentioned by the
informants, 63 (38.1%) were mentioned by three or more informants. On the basis
of their primary uses, 21 of these plants were reported to relieve skin
disorders, 17 for urinary system disorders, 16 for gastric disorders, nine for
cancer and prostate disorders, eight for arthritis, five for respiratory
problems, and five for other ailments. Indices on fidelity levels (FLs),
relative popularity level (RPL), and rank/​order priority (ROP) were calculated.
Plants were classified in two groups: 'popular' (RPL=1) or 'unpopular' (RPL<1).
The following plant species were classified as popular in this study: Teucrium
polium, Matricaria aurea, Urtica pilulifera, Paronychia argentea, Petroselinum
sativum, and Salvia fruticosa. The remaining 57 species were classified as
'unpopular'. Fifty/​nine plants were claimed to be effective against cancer and
prostate disorders, which include Arum dioscorides, U. pilulifera, Allium
sativum, Viscum cruciatum, and Allium cepa.

PMID: 11025160 [PubMed /​ indexed for MEDLINE]

290: J Econ Entomol. 2000 Aug;93(4):1216/​21.

Effect of nectar composition and nectar concentration on honey bee (Hymenoptera:
Apidae) visitations to hybrid onion flowers.

Silva EM, Dean BB.

Department of Horticulture and Landscape Architecture, Washington State
University Irrigated Agriculture Research and Extension Center, Prosser 99350,
USA.

Floral nectar characteristics of nine inbred lines of onion (Allium cepa L.)
were examined to determine their influence on the attractiveness of the onion
flowers to honey bees (Apis mellifera L.). Potassium concentrations and sugar
concentrations of the nectar did not significantly correlate with the number of
bee visits received by an umbel. The average amount of nectar produced by both
the umbels and the individual florets was significantly positively correlated
with the number of bee visits. Our results suggest that selection for flowers
with high nectar production may lead to a higher rate of pollination of the
onion seed crop.

Publication Types:
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 10985033 [PubMed /​ indexed for MEDLINE]

291: Plant Physiol. 2000 Sep;124(1):397/​405.

The mechanical properties and molecular dynamics of plant cell wall
polysaccharides studied by Fourier/​transform infrared spectroscopy.

Wilson RH, Smith AC, Kacurakova M, Saunders PK, Wellner N, Waldron KW.

Institute of Food Research, Norwich Research Park, Norwich NR4 7UA, United
Kingdom. reg.wilson@bbsrc.ac.uk

Polarized one/​ and two/​dimensional infrared spectra were obtained from the
epidermis of onion (Allium cepa) under hydrated and mechanically stressed
conditions. By Fourier/​transform infrared microspectroscopy, the orientation of
macromolecules in single cell walls was determined. Cellulose and pectin
exhibited little orientation in native epidermal cell walls, but when a
mechanical stress was placed on the tissue these molecules showed distinct
reorientation as the cells were elongated. When the stress was removed the
tissue recovered slightly, but a relatively large plastic deformation remained.
The plastic deformation was confirmed in microscopic images by retention of some
elongation of cells within the tissue and by residual molecular orientation in
the infrared spectra of the cell wall. Two/​dimensional infrared spectroscopy was
used to determine the nature of the interaction between the polysaccharide
networks during deformation. The results provide evidence that cellulose and
xyloglucan associate while pectin creates an independent network that exhibits
different reorientation rates in the wet onion cell walls. The pectin chains
respond faster to oscillation than the more rigid cellulose.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 10982452 [PubMed /​ indexed for MEDLINE]

292: Ceska Slov Farm. 2000 Jul;49(4):162/​7.

[Interactions between herbal medicines and drugs]

[Article in Czech]

Tumova L.

Katedra farmakognozie Farmaceuticke fakulty Univerzity Karlovy, Hradec Kralove.

At present the use of medicaments of plant origin is on the increase. It is
therefore necessary to take into consideration that there exist known as well as
potential interactions between the medicament of the medicinal plant. The
problematic plants include Echinacea, Allium cepa, Gingko biloba, Panax ginseng,
as well as Hypericum perforatum, Valeriana officinalis, or Glycyrrhiza glabra.
Its use should be limited, or completely excluded in the cases of simultaneous
therapy with, e.g., warfarin, hepatotoxically acting medicaments, MAOI
inhibitors, phenelzin sulphate, or phenytoin, as they may decrease of completely
eliminate the therapeutic effect of the administered drugs, or they may cause a
toxic damage to the organism.

Publication Types:
English Abstract

PMID: 10953464 [PubMed /​ indexed for MEDLINE]

293: J Exp Bot. 2000 Mar;51(344):605/​15.

Effects on the growth of carrots (Daucus carota L.), cabbage (Brassica oleracea
var. capitata L.) and onion (Allium cepa L.) of restricting the ability of the
plants to intercept resources.

Peach L, Benjamin LR, Mead A.

Horticulture Research International, Wellesbourne, Warwick, UK.

The objective of this paper is to assess the size and penetration of edge
effects in carrot, cabbage and onion field crops and the extent to which these
edge effects are modified by the presence of aerial or soil competition between
the crop rows. In all three crops, large weight differences developed between
the plants in the edge rows and those in the central rows. There was no
indication of plant weight fluctuating between large and small values with each
successive row in from the edge, as suggested by others. In carrot and onion,
edge effects were greatly reduced by the presence of either white reflective
aerial partitions or soil partitions, indicating that these species competed for
both light and soil resources in UK field conditions. In cabbage, the mere
presence of clear aerial partitions between rows reduced edge effects and there
was little effect of soil partitions. This indicates the predominance of shoot
over root competition in this species. The differences between species are
possibly related to the architectural flexibility of their shoots. These results
suggest that, within crops, carrot and onion plants compete for light over a
distance of about 20 cm in each direction and for below/​ground resources over a
distance of about 50 cm in each direction. For cabbage, interactions between
plants appeared to be dominated by the requirement for sufficient space to
deploy the shoots for efficient light interception.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 10938817 [PubMed /​ indexed for MEDLINE]

294: Plant Sci. 2000 Jul 28;156(2):221/​226.

Improvement of in vitro gynogenesis induction in onion (Allium cepa L.) using
polyamines.

Martinez LE, Aguero CB, Lopez ME, Galmarini CR.

Catedra de Fisiologia Vegetal, Facultad de Ciencias Agrarias, CC No. 7, 5505,
Chacras de Coria, Mendoza, Argentina

The effects of polyamines on gynogenetic embryogenesis and regeneration of
plantlets in onion were studied. Whole flowers from two onion genotypes,
'Valcatorce INTA' cultivar and 'Torrentina' population, were used as initial
explants. Embryo induction was greatest with a combined treatment of 2 mM
putrescine and 0.1 mM spermidine. Addition of putrescine alone, with a few
exceptions, did not have any significant effect on either embryo induction or
haploid plantlet production for both onion genotypes. 'Torrentina' showed a
higher embryo generation capacity (9.5%) than 'Valcatorce INTA' (2.8%). Fast
regeneration of embryos was achieved (from 60 to 90 days) as compared to a
previously reported time of 46/​152 days. The use of spermidine (0.1 mM) after 15
days of culture promoted further embryo maturation and plantlet formation.
'Torrentina' produced more haploid plants (1.90%). This is the first report of
successful use of polyamines for induction of gynogenic embryos and regeneration
of onion plantlets.

PMID: 10936529 [PubMed /​ as supplied by publisher]

295: Toxicol Lett. 2000 Jul 27;116(1/​2):61/​8.

Antioxidant effect of onion oil (Allium cepa. Linn) on the damages induced by
nicotine in rats as compared to alpha/​tocopherol.

Helen A, Krishnakumar K, Vijayammal PL, Augusti KT.

Department of Biochemistry, University of Kerala, Kariavattom,
Thiruvananthapuram, India.

The beneficial effects of onion oil as an antioxidant has been assessed in
nicotine administered rats by studying whether the peroxidative damage caused by
nicotine can be effectively combated with the onion oil and the effects compared
to vitamin E, a highly efficient antioxidant. Lipid peroxidation products and
antioxidant defence system have been studied in liver, lungs, and heart. The
rats were injected with nicotine (0.6 mg/kg body wt.) and simultaneously given
onion oil (100 mg/kg body wt.) or vitamin E (100 mg/kg body wt.) for 21 days.
Concentration of free fatty acids, TBA reactive substances (TBARS), conjugated
dienes and hydroperoxides were significantly increased in the tissues of
nicotine treated rats as compared to normal rats. Onion oil supplemented to
nicotine treated rats showed increased resistance to lipid peroxidation and the
effect was near to that of vitamin E fed rats. The activity of catalase and
superoxide dismutase decreased in nicotine treated rats.
Antioxidants/​glutathione content, vitamin C and retinol showed no significant
difference but liver vitamin E content significantly decreased in nicotine
treated rats. On onion oil or vitamin E supplementation, the concentration of
antioxidants were significantly raised in all the tissues studied, however, a
significantly increased concentration of glutathione, vitamin E and retinol was
noticed in vitamin E+nicotine treated rats. Thus, these results indicate that
onion oil is an effective antioxidant against the oxidative damage caused by
nicotine as compared to vitamin E.

Publication Types:
Comparative Study

PMID: 10906423 [PubMed /​ indexed for MEDLINE]

296: J Econ Entomol. 2000 Jun;93(3):1031/​4.

Response of omnivorous leafroller (Lepidoptera: Tortricidae) and onion thrips
(Thysanoptera: Thripidae) to low/​temperature storage.

Yokoyama VY, Miller GT.

Horticultural Crops Research Laboratory, USDA/​ARS, Fresno, CA 93727, USA.

Eggs and first/​fifth instars of omnivorous leafroller, Platynota stultana
Walshingham, had a mean percentage survival to the adult stage of 60.7/​95.2% for
nonexposed immatures and 14.5/​54.3% for immatures exposed to 1 wk at 0/​1 degree
C. Exposures of 2/​5 wk resulted in 0/​6.7% survival, and a 6/​wk exposure resulted
in < 1% survival of all stages tested. A significant reduction in survival of
all larval stages occurred between exposures of 0 and 1 wk and between 1 wk and
2/​6 wk. Survival of eggs after exposures of 0 and 1 wk was significantly
different than survival after exposures of 2/​6 wk. The second instar was the
stage least susceptible to low/​temperature storage. Adults that were exposed to
low temperature for 1 wk in the third through fifth instars laid a mean of
120/​289 eggs per female, and the mean percentage viability of the eggs ranged
from 56.2 to 71.4%. Mean percentage survival of adults and nymphs of onion
thrips, Thrips tabaci Lindeman, was inversely related to the duration of
exposure from 1 through 3/​6 wk at 0/​1 and 5 degrees C and was lower at 0/​1
(0.2/​52.5%) than at 5 degrees C (17.6/​66.6%). Exposure to 0/​1 degree C for 4 wk
attained 91.2% control, which increased to 99.8% after 6 wk. Low/​temperature
storage has potential to control omnivorous leafroller in table grapes, Vitis
vinifera L., and onion thrips in onions, Allium cepa L.

PMID: 10902368 [PubMed /​ indexed for MEDLINE]

297: J Agric Food Chem. 2000 Jul;48(7):3003/​7.

Natural and synthetic podolactones with potential use as natural herbicide
models.

Macias FA, Simonet AM, Pacheco PC, Barrero AF, Cabrera E, Jimenez/​Gonzalez D.

Departamento de Quimica Organica, Facultad de Ciencias, Universidad de Cadiz,
C/Republica Saharaui s/n, Apartado 40, 11510 Puerto Real, Cadiz, Spain.
famacias@uca.es

A collection of 11 natural and synthetic podolactones have been tested as
allelochemicals in a range between 10(/​4) and 10(/​9) M, and their potential use
as natural herbicide models is discussed. Their effects on the germination and
growth of the dicots Lactuca sativa (cv. Nigra and cv. Roman), Lepidium sativum,
and Lycopersicon esculentum and the monocots Allium cepa, Hordeum vulgare, and
Triticum aestivum as standard target species have been studied. An important
inhibitory effect on the germination and growth of all tested species (average =
90%) was produced by compounds 9/​11 at 10(/​4) M. The specific structural
requirements related to their activities are studied. On the basis of these
results, their use as potential natural herbicide models is proposed.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 10898656 [PubMed /​ indexed for MEDLINE]

298: Analyst. 2000 Jan;125(1):71/​8.

Selenium speciation in enriched and natural samples by HPLC/​ICP/​MS and
HPLC/​ESI/​MS with perfluorinated carboxylic acid ion/​pairing agents.

Kotrebai M, Birringer M, Tyson JF, Block E, Uden PC.

Department of Chemistry, University of Massachusetts, Amherst 01003/​4510, USA.

Selenium/​enriched plants, such as hyperaccumulative phytoremediation plants
(Astragalus praleongus, 517 micrograms g/​1 Se, and Brassica juncea, 138
micrograms g/​1 Se in dry sample), yeast (1200, 1922 and 2100, micrograms g/​1 Se
in dry sample), ramp (Allium tricoccum, 48, 77, 230, 252, 405 and 524 micrograms
g/​1 Se in dry sample), onion (Allium cepa, 96 and 140 micrograms g/​1 Se in dry
sample) and garlic (Allium sativum, 68, 112, 135, 296, 1355 micrograms g/​1 Se in
dry sample) were analyzed by HPLC/​ICP/​MS for their selenium content and
speciation after hot water and enzymatic extractions. Reference samples with
natural selenium levels, such as onion and garlic controls, cooking garlic
powder, baking yeast powder and a commercial garlic supplement were also
analyzed. Selected samples were also examined by HPLC/​electrospray ionization
(ESI)/​MS. HPLC was mostly carried out with 0.1% heptafluorobutanoic acid (HFBA)
as ion/​pairing agent in 1 + 99 v/v methanol/​water solution, but 0.1%
trifluoroacetic acid (TFA) in 1 + 99 v/v methanol/​water solution was also
utilized to permit chromatography for compounds that did not elute with HFBA.
More than 75% of the total eluting selenium compounds, based upon element
specific detection, were identified from retention time data and standard
spiking experiments, and between 60 and 85% of compounds were identified by MS,
with up to 25% of the total eluting molecular selenium species being
unidentified as yet. Limits of quantification (LOQ, defined as the concentration
giving an S/N of 10) for HPLC/​ICP/​MS were in the range 2/​50 ng mL/​1 Se in the
injected extracts for the selenium/​enriched samples and 2/​10 ng mL/​1 Se for the
natural selenium level samples. LOQ values for HPLC/​ESI/​MS were ca. 100 times
higher than those measured by HPLC/​ICP/​MS.

Publication Types:
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.
Research Support, U.S. Gov't, P.H.S.

PMID: 10885064 [PubMed /​ indexed for MEDLINE]

299: Plant Physiol. 2000 May;123(1):71/​80.

Cloning, developmental, and tissue/​specific expression of sucrose:sucrose
1/​fructosyl transferase from Taraxacum officinale. Fructan localization in
roots.

Van den Ende W, Michiels A, Van Wonterghem D, Vergauwen R, Van Laere A.

Department of Biology, Botany Institute, K.U., Kardinaal Mercierlaan 92, B/​3001
Heverlee, Belgium. wim.vandenede@bio.kuleven.ac.be

Sucrose:sucrose 1/​fructosyl transferase (1/​SST) is the key enzyme initiating
fructan synthesis in Asteraceae. Using reverse transcriptase/​PCR, we isolated
the cDNA for 1/​SST from Taraxacum officinale. The cDNA/​derived amino acid
sequence showed very high homology to other Asteracean 1/​SSTs (Cichorium intybus
86%, Cynara scolymus 82%, Helianthus tuberosus 80%), but homology to 1/​SST from
Allium cepa (46%) and Aspergillus foetidus (18%) was much lower. Fructan
concentrations, 1/​SST activities, 1/​SST protein, and mRNA concentrations were
compared in different organs during vegetative and generative development of T.
officinale plants. Expression of 1/​SST was abundant in young roots but very low
in leaves. 1/​SST was also expressed at the flowering stages in roots, stalks,
and receptacles. A good correlation was found between northern and western blots
showing transcriptional regulation of 1/​SST. At the pre/​flowering stage, 1/​SST
mRNA concentrations and 1/​SST activities were higher in the root phloem than in
the xylem, resulting in the higher fructan concentrations in the phloem. Fructan
localization studies indicated that fructan is preferentially stored in phloem
parenchyma cells in the vicinity of the secondary sieve tube elements. However,
inulin/​like crystals occasionally appeared in xylem vessels.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 10806226 [PubMed /​ indexed for MEDLINE]

300: Prostaglandins Leukot Essent Fatty Acids. 2000 Feb;62(2):55/​73.

Garlic and onions: their effect on eicosanoid metabolism and its clinical
relevance.

Ali M, Thomson M, Afzal M.

Department of Biological Sciences, Faculty of Science, Kuwait University, Safat.
muslim@kuc01.kuniv.edu.kw

Garlic (Allium sativum) and onion (Allium cepa) are among the oldest of all
cultivated plants. Additionally, both plants have been used as medicinal agents
for thousands of years. Both garlic and onion have been shown to have
applications as antimicrobial, antithrombotic, antitumor, hypolipidaemic,
antiarthritic and hypoglycemic agents. In recent years, extensive research has
focussed on the beneficial and medicinal properties of garlic and onions. In
particular, the use of these agents in the treatment and prevention of
cardiovascular disease and cancer is an area of considerable investigation and
interest.

Publication Types:
Review

PMID: 10780871 [PubMed /​ indexed for MEDLINE]

301: Plant Physiol. 2000 Apr;122(4):1269/​79.

A novel alliinase from onion roots. Biochemical characterization and cDNA
cloning.

Lancaster JE, Shaw ML, Joyce MD, McCallum JA, McManus MT.

New Zealand Institute for Crop and Food Research Limited, Private Bag 4704,
Christchurch, New Zealand. jlancaster@xtra.co.nz

We have purified a novel alliinase (EC 4.4.1.4) from roots of onion (Allium cepa
L.). Two isoforms with alliinase activity (I and II) were separated by
concanavalin A/​Sepharose and had molecular masses of 52.7 (I) and 50.5 (II) kD
on sodium dodecyl sulfate/​polyacrylamide gel electrophoresis, and 51 (I) and
57.5 (II) kD by gel filtration fast/​protein liquid chromatography. Isoform I had
an isoelectric point of 9.3, while isoform II had isoelectric points of 7.6,
7.9, 8.1, and 8.3. The isoforms differed in their glycosylation. Both contained
xylose/fucose containing complex/​type N/​linked glycans, and isoform II also
contained terminal mannose structures. Both isoforms had activity with
S/​alk(en)yl/​L/​cysteine sulfoxides. Unlike other allium alliinases, A. cepa root
isoforms had cystine lyase activity. We cloned a gene from A. cepa root cDNA and
show that it codes for A. cepa root alliinase protein. Homology to other
reported allium alliinase genes is 50%. The gene coded for a protein of mass
51.2 kD, with two regions of deduced amino acid sequence identical to a 25/​ and
a 40/​amino acid region, as determined experimentally. The A. cepa root alliinase
cDNA was expressed mainly in A. cepa roots. The structure and function of the
alliinase gene family is discussed.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 10759524 [PubMed /​ indexed for MEDLINE]

302: Mutat Res. 2000 Feb 16;465(1/​2):1/​9.

Aluminium triggers genotoxic adaptation to methyl mercuric chloride and ethyl
methane sulfonate, but not to maleic hydrazide in plant cells in vivo.

Patra J, Baisakhi B, Mohapatro MK, Panda BB.

Department of Botany, Genecology and Tissue Culture Laboratory, Berhampur
University, Berhampur 760 007, Orissa, India.

Non/​toxic, conditioning doses of aluminium chloride were tested for induction of
adaptive response to the genotoxic challenge doses of methyl mercuric chloride
(MMCl), maleic hydrazide (MH) and ethyl methane sulfonate (EMS). Embryonic shoot
cells of Hordeum vulgare and root meristem cells of Allium cepa were employed as
the assay systems. Plant tissues fixed at different recovery hours following the
challenge treatments with or without prior Al/​conditioning were analyzed for
cells with genotoxicity markers that include spindle and/or chromosome
aberrations and micronuclei (MNC). The results provided evidence that Al(3+)
triggered adaptive response that protected the plant cells from the genotoxicity
of MMCl and EMS. Al(3+), however, failed to induce adaptive response against the
genotoxicity of MH. A comparison of Al/​induced adaptive response with that
induced by heavy metals: Cd(2+), Cu(2+), Hg(2+), Ni(2+), Pb(2+), Zn(2+) and
oxidative agents: hydrogen peroxide (H(2)O(2)) and paraquat (PQ) pointed to the
similarity of Al/​adaptive response to that of PQ rather than to other heavy
metals or H(2)O(2). Al/​induced adaptive response demonstrated in the present
study to MMCl and EMS possibly involved antioxidant defense and DNA repair
systems, respectively.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 10708964 [PubMed /​ indexed for MEDLINE]

303: Nahrung. 2000 Feb;44(1):32/​7.

Quality changes of onion (Allium cepa L.) as affected by the drying process.

Adam E, Muhlbauer W, Esper A, Wolf W, Spiess W.

University of Hohenheim, Institute for Agricultural Engineering in the Tropics
and Subtropics, Stuttgart, Germany.

Thin layer drying experiments of sliced onion were carried out under different
controlled conditions using a laboratory dryer. Quality changes of the dried
product were evaluated by analysis of colour, pyruvate, chemical and sensory
parameters. The results obtained proved that drying temperatures above 65
degrees C exert a pronounced influence on colour changes. The pyruvate content
decreased with increasing of temperature and slice thickness. The sugar content
was also found to be significantly influenced by the drying temperature. The
rate of ascorbic acid degradation decreased with increasing temperature and
slice thickness. Significant correlations were obtained between chemically
determined pyruvate content and sensory evaluated odour of the dried onion.

Publication Types:
Clinical Trial
Research Support, Non/​U.S. Gov't

PMID: 10702997 [PubMed /​ indexed for MEDLINE]

304: Cytobios. 1999;100(395):171/​80.

Effect of cisplatin on Allium cepa root meristem cells.

Khynriam D, Prasad SB.

Cell and Tumour Biology Laboratory, Department of Zoology, School of Life
Sciences, North/​Eastern Hill University, India.

Allium cepa root growth was retarded by cisplatin treatment in a dose/​dependent
manner. A decrease in the mitotic index (MI) and an increase in the number of
interphase cells was seen in cisplatin treated root tips. An increase in the
frequency of abnormal mitoses and chromosomal aberrations was also observed in
cisplatin treated groups which indicates its genotoxic effect on plant cells.
The endogenous glutathione (GSH) level in the root tips decreased significantly
after cisplatin treatment which may favour its increased interaction with
cellular DNA thereby developing enhanced chromosomal aberrations and affecting
cell divisions and root growth. It is suggested that the decrease in endogenous
GSH may be related to the development of cisplatin/​mediated genotoxic effects in
plants.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 10701097 [PubMed /​ indexed for MEDLINE]

305: Free Radic Res. 1999 Dec;31 Suppl:S121/​7.

Effects of an oxidizing agent (hydrogen peroxide) on the glutathione system in
epidermal cells of Allium cepa L. investigated by histochemical staining.

Muller M, Tausz M, Wonisch A, Grill D.

Institute of Plant Physiology, University of Graz, Austria.

The glutathione system in epidermal cells of Allium cepa L. was measured by a
quantitative image analysis method, using histochemical staining by
monochlorobimane. Blockage of thiol groups with N/​ethylmaleimide decreased
fluorescence to a small rest fluorescence of maximum 5%. Pre/​treatment with
dithiothreitol increased fluorescence yield in all cells compared to the
monochlorobimane treatment alone. These results correspond to the blockage or
the reduction of the total pool of glutathione in the cells. After treatment
with N/​ethylmaleimide and subsequent incubation with dithiothreitol followed by
labelling with bimane a low fluorescence yield was observed which correspond to
the proportion of GSSG. Specimens that were incubated in H2O2 prior to the
treatments described above exhibited a decrease in total glutathione and in
reduced glutathione and an increase in the proportion of GSSG compared to the
control.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 10694050 [PubMed /​ indexed for MEDLINE]

306: Genome. 1999 Dec;42(6):1208/​16.

Random amplified polymorphic DNA analysis, genome size, and genomic in situ
hybridization of triploid viviparous onions

Puizina J, Javornik B, Bohanec B, Schweizer D, Maluszynska J, Papes D.

Department of Biology, Faculty of Natural Sciences and Mathematics, University
of Split, Croatia. puizina@mapmf.pmfst.hr

Triploid viviparous onions (Allium cepa L. var. viviparum Metzg. (ALEF.),
auct.), (2n = 3x = 24), are known in some countries only as a rare relic crop,
while in other parts of the world they are still traditionally or even
commercially cultivated. Results indicating an identical random amplified
polymorphic DNA (RAPD) banding pattern and the same DNA content (2C = 43.4 pg)
establish the high genetic similarity and the unique origin of the Croatian
clone Ljutika and the Indian clone Pran. In order to determine the parental
Allium species of these natural triploid hybrids, genomic fluorescent in situ
hybridization (GISH) was applied. Biotinylated genomic DNAs from six diploid
Allium species (A. cepa L., A. fistulosum L., A. roylei Stearn, A. vavilovii M.
Pop. et Vved., A. galanthum Kar. et Kir., A. oschaninii O. Fedtsch.) were used
as probes in this study. While probes obtained from genomic DNA of A. cepa, A.
vavilovii, and A. roylei hybridized to somatic chromosomes of Ljutika probes
from A. fistulosum, A. galanthum, and A. oschaninii did not. The DNA probes of
A. cepa and A. roylei each completely or predominantly labelled one genome
(eight chromosomes). A few chromosomes, the markers of the triploid karyotype,
were not completely labelled by any probe applied. Our GISH results indicate
that triploid viviparous onions might possess a complex triparental genome
organization.

PMID: 10659789 [PubMed /​ as supplied by publisher]

307: J Ethnopharmacol. 1999 Dec 15;68(1/​3):183/​92.

Traditional antihelmintic, antiparasitic and repellent uses of plants in Central
Italy.

Guarrera PM.

Dipartimento Biologia Vegetale, Universita La Sapienza, Rome, Italy.

The uses of 51 plants of Marche, Abruzzo and Latium, distributed in 28 families,
are listed here. Memories and news of continued use of the plants in these
sectors were collected from farmers and shepherds in person (mostly old people).
The plants most frequently used as antiparasitics and repellents are Juglans
regia, Lupinus albus, Ruta graveolens, Fraxinus ornus, Datura stramonium,
Artemisia absinthium, Allium cepa, while R. graveolens, Cucurbita maxima, A.
absinthium, Allium sativum are the most commonly used as antihelmintics.

PMID: 10624877 [PubMed /​ indexed for MEDLINE]

308: Planta. 1999 Nov;210(1):80/​4.

Osmotic water permeability of isolated vacuoles

Morillon R, Lassalles JP.

UPRESA CNRS 6037, Universite de Rouen, Faculte des Sciences, F/​76821
Mont/​Saint/​Aignan cedex, France.

We measured the osmotic water permeability (P(os)) of vacuoles isolated from
onion (Allium cepa L.), rape (Brassica napus L.), petunia (Petunia hybrida
Hook.) and red beet (Beta vulgaris L.). For all the vacuolar types investigated,
P(os) values were in the range 200/​1000 &mgr;m s(/​1). The change in membrane
surface area induced by an osmotic gradient was smaller than 2/​6%. The vacuolar
P(os) values for red beet and onion were reduced by 1 mM HgCl(2), to 14% and 30%
of the control values, respectively, but were partially restored to 51% and 76%
by 5 mM beta/​mercaptoethanol. These results suggest that aquaporins were present
in all the vacuoles tested. In HgCl(2)/​treated onion vacuoles, the reduced P(os)
(56 &mgr;m s(/​1)) had a low activation energy (approx. 6 kJ mol(/​1)), indicating
that water permeation was still occurring mainly via aquaporins, and that the
water permeability of the lipid part of the vacuolar membrane is probably very
low.

PMID: 10592035 [PubMed /​ as supplied by publisher]

309: Mutagenesis. 1999 Nov;14(6):547/​56.

Comet assay application in environmental monitoring: DNA damage in human
leukocytes and plant cells in comparison with bacterial and yeast tests.

Poli P, Buschini A, Restivo FM, Ficarelli A, Cassoni F, Ferrero I, Rossi C.

Istituto di Genetica, Universita degli Studi di Parma, Parco Area delle Scienze
11/a, 43100 Parma and ARPA Emilia Romagna, Sezione di Parma, Parma, Italy.
mutgen@unipr.it

Urban airborne particulate is a complex mixture of air pollutants, many of which
have not been identified. However, short/​term mutagenesis tests together with
chemicophysical parameter analysis are able to better assess air quality and
genotoxic load. The findings of continuous monitoring (January 1991/​August 1998)
of urban air genotoxicity of a Po Valley town (Italy) on Salmonella typhimurium
and Saccharomyces cerevisiae are reported. During this period, various measures
(catalytic devices, unleaded fuels, annual vehicle overhaul, etc.) to improve
air/​dispersed pollutant control were enforced. However, a continuous presence of
genotoxic compounds is shown and more qualitative than quantitative changes are
evident. We also demonstrate the ability of the Comet assay to detect
DNA/​damaging agents in airborne particulate samples. We applied the test to
human leukocytes and, with major improvements, to plant cells (Allium cepa roots
and epigean tissues of Impatiens balsamina). The first findings on human
leukocytes confirm the sensitivity of this assay, its peculiarity and its
applicability in assessing genotoxicity in environmental samples. The capability
of plants to show the response of multicellular organisms to environmental
pollutants largely counterbalances a probable lowering in sensitivity. Moreover,
application of the Comet test to epigean tissues could be useful in estimating
the bioavailability of and genotoxic damage by air pollutants, including
volatile compounds (ozone, benzene, nitrogen oxides, etc.) to higher plants.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 10567029 [PubMed /​ indexed for MEDLINE]

310: Planta. 1999 Oct;209(4):424/​34.

Changes in onion root development induced by the inhibition of peptidyl/​prolyl
hydroxylase and influence of the ascorbate system on cell division and
elongation

De Tullio MC, Paciolla C, Dalla Vecchia F, Rascio N, D'Emerico S, De Gara L,
Liso R, Arrigoni O.

Istituto Botanico, Universita di Bari, via E. Orabona 4, I/​70125 Bari, Italia.

Post/​translational hydroxylation of peptide/​bound proline residues, catalyzed by
peptidyl/​prolyl/​4 hydroxylase (EC 1.14.11.2) using ascorbate as co/​substrate, is
a key event in the maturation of a number of cell wall/​associated
hydroxyproline/​rich glycoproteins (HRGPs), including extensins and
arabinogalactan/​proteins, which are involved in the processes of wall
stiffening, signalling and cell proliferation. Allium cepa L. roots treated with
3, 4/​DL/​dehydroproline (DP), a specific inhibitor of peptidyl/​prolyl
hydroxylase, showed a 56% decrease in the hydroxyproline content of HRGP.
Administration of DP strongly affected the organization of specialized zones of
root development, with a marked reduction of the post/​mitotic isodiametric
growth zone, early extension of cells leaving the meristematic zone and a huge
increase in cell size. Electron/​microscopy analysis showed dramatic alterations
both to the organization of newly formed cell walls and to the adhesion of the
plasma membranes to the cell walls. Moreover, DP administration inhibited cell
cycle progression. Root tips grown in the presence of DP also showed an increase
both in ascorbate content (+53%) and ascorbate/​specific peroxidase activity in
the cytosol (+72%), and a decrease in extracellular "secretory" peroxidase
activity (/​73%). The possible interaction between HRGPs and the ascorbate system
in the regulation of both cell division and extension is discussed.

PMID: 10550623 [PubMed /​ as supplied by publisher]

311: Vet Hum Toxicol. 1999 Oct;41(5):316/​9.

Antioxidant role of oils isolated from garlic (Allium sativum Linn) and onion
(Allium cepa Linn) on nicotine/​induced lipid peroxidation.

Helen A, Rajasree CR, Krishnakumar K, Augusti KT, Vijayammal PL.

Department of Biochemistry, University of Kerala, Kariavattom, India.

Nicotine, a major component of tobacco, is partly responsible for the
development of atherosclerosis. It has been suggested that antioxidant nutrients
are protective against degenerative diseases. So we have studied the antioxidant
effect of oils isolated from onion and garlic on nicotine/​induced lipid
peroxidation in rat tissues. The lipid peroxidation products and scavenging
enzymes were assessed in liver, lungs, heart and kidney. The rats were treated
with 0.6 mg nicotine/kg bw and simultaneously given 100 mg garlic or onion
oils/kg bw for 21 d. Thiobarbituric acid reactive substances, conjugated dienes
and hydroperoxides concentrations were significantly increased in the tissues of
nicotine/​treated rats. Both the garlic oil and onion oil supplementation to
nicotine/​treated rats increased resistance to lipid peroxidation. The activities
of catalase, superoxide dismutase and glutathione peroxidase decreased in
nicotine/​treated rats, but there was a trend to increased glutathione content.
With garlic oil or onion oil supplementation, nicotine/​treated rats had
increased activities of antioxidant enzymes and increased concentrations of
glutathione. These results indicate that oils of garlic and onion are effective
antioxidants against the oxidative damage caused by nicotine.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 10509436 [PubMed /​ indexed for MEDLINE]

312: Folia Histochem Cytobiol. 1999;37(3):199/​208.

Immunocytochemical localization of pectins in the maturing anther of Allium cepa
L.

Golaszweska B, Bednarska E.

Laboratory of Developmental Biology, Institute of General and Molecular Biology,
N. Copernicus University, Torun, Poland.

Distribution of pectins in cell walls of maturing anther of Allium cepa L. was
investigated. The monoclonal antibodies against defined epitopes of pectin were
used: JIM5 recognizing unesterified pectin and JIM7 recognizing esterified
pectin. It has been found that the cell walls of all anther tissues mainly
contain esterified pectins. In the somatic tissues only small amounts of
unesterified pectins are present in the cell wall junctions and adjacent middle
lamellae and in the cell walls of the connective tissue. Thickening of the
epiderm cell walls and growth of trabeculae in endothecium are completed through
deposition of esterified pectins. In the cell walls of the middle layer and
tapetum, unesterified pectins have been found only prior to their
disintegration. The primary wall of microsporocytes is made up mainly of
esterified pectins. Unesterified pectins occur outside microsporocytes only
prior to the callose isolation stage. The presence of esterified pectins has
also been detected on the surface of the callose wall surrounding dividing
microsporocytes. Lysis of those pectins takes place after microsporogenesis,
simultaneously with the lysis of the callosic walls. Before these processes
pectins are unesterified. In the sporoderm of pollen grains mainly esterified
pectins occur. They have been localized in the intine and aperture. The level of
unesterified pectins in the intine is markedly lower.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 10482252 [PubMed /​ indexed for MEDLINE]

313: J Microsc. 1999 Aug;195(Pt 2):139/​46.

Localization of lead in Allium cepa L. cells by electron microscopy.

Antosiewicz D, Wierzbicka M.

Environmental Plant Pollution Laboratory, Department of Morphogenesis, Institute
of Plant Experimental Biology, The University of Warsaw, Krakowskie Przedmiescie
26/28, 00/​927 Warsaw, Poland.

The study of mechanisms by which plants tolerate lead requires ultrastructural
observations of lead distribution in cells. However, the conventional technique
used in electron microscopy brings up the problem of lead translocation from
tissues during chemical processing. If most of the lead is washed out of
tissues, then the method is not suitable for this type of study; if, however, it
remains in the tissues, the method can be used. The amount of lead washed out of
Allium cepa root tips during successive stages of fixing and dehydrating was
determined in this study. Allium cepa plants were treated with Pb(NO3)2 in
hydroponic cultures. The conventional fixing (GA, OsO4) and dehydration (alcohol
+ propylene oxide or acetone) methods used in the preparation of tissues for
electron microscopy were then applied to root tips. The lead content in tissues
and in reagents was analysed in the successive stages of the procedure. It was
shown that 96.2% of the lead taken up was retained in the tissues and was not
washed out during fixing and dehydrating. Of the 3.8% of the lead lost in the
chemical procedure, about half was washed out during fixing in osmium tetroxide.
This reagent is thus the least suitable for this type of study. Our study showed
that the conventional electron microscopy preparative technique is appropriate
for studying the distribution of lead deposits in A. cepa root cells, owing to
the way in which lead is compartmentalized/sequestered in plant cells.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 10460677 [PubMed /​ indexed for MEDLINE]

314: Dermatol Surg. 1999 Apr;25(4):267/​9.

Comment in:
Dermatol Surg. 1999 Aug;25(8):670/​1.

Pilot study evaluating topical onion extract as treatment for postsurgical
scars.

Jackson BA, Shelton AJ.

Department of Medical Specialities, The University of Texas M.D. Anderson Cancer
Center, Houston, Texas 77030/​4095, USA.

BACKGROUND: Post surgical scars can be erythematous, raised, pruritic and
painful. Numerous modalities are available to improve the appearance and
symptomatology of these scars. A topical onion gel extract is the newest in the
armamentarium of scar treatments. The active ingredient in this gel is allium
cepa. Published studies evaluating the usefulness of this gel in the treatment
of scars are not available. OBJECTIVE: To evaluate the effectiveness of topical
onion gel extract in improving the appearance and symptomatology of postsurgical
scars and to compare the results of its use to those of a topical emollient
ointment. METHODS: Seventeen patients with surgical scars resulting from Mohs
surgery were assigned to 1 of 2 groups on the day of suture removal. Each group
applied a designated topical product 3 times a day for 1 month. Photographic
documentation and questionnaires using a visual analog scale were completed for
each scar enrolled in the study. RESULTS: Using the Fischer's exact test, no
statistically significant difference between pre/​ and posttreatment evaluations
of scar erythema and pruritus in patients using topical onion extract gel was
found. A statistically significant reduction in scar erythema was found in
patients using a petrolatum based ointment. CONCLUSIONS: Scar hydration is an
important factor in wound healing and can be achieved with topical
petrolatum/​based ointment. Topical onion gel extract was ineffective in
improving scar erythema and pruritus in our patients.

Publication Types:
Clinical Trial
Randomized Controlled Trial

PMID: 10417579 [PubMed /​ indexed for MEDLINE]

315: Chromosoma. 1999 Jul;108(3):190/​9.

A novel histone variant localized in nucleoli of higher plant cells.

Tanaka I, Akahori Y, Gomi K, Suzuki T, Ueda K.

Department of Biology, Faculty of Science, Yokohama City University, Seto 22/​2,
Kanazawa/​ku, Yokohama 236/​0027, Japan. itanaka@yokohama/​cu.ac.jp

Immunofluorescence staining with antisera raised against p35, a basic nuclear
protein that accumulates in the pollen nuclei of Lilium longiflorum,
specifically stained the nucleoli in interphase nuclei of somatic tissues,
including root and leaf, and in pachytene nuclei during meiotic division,
whereas antisera raised against histone H1 uniformly stained the entire
chromatin domain with the exception of the nucleoli in these nuclei. Further,
p35/​specific antisera stained the nucleoli in root and leaf nuclei of the
monocotyledonous plants Tulipa gesneriana, Allium cepa and Triticum aestivum and
of the dicotyledonous plants Vicia faba and Nicotiana tabacum. Thus, these novel
antisera stained the nucleoli in cells of all higher plants examined, although
the staining patterns within nucleoli were somewhat different among plant
species and tissues. The full/​length cDNA of p35 was cloned on the basis of the
partial amino acid sequence. The deduced amino acid composition and amino acid
sequence of p35 indicate that this nucleolar protein is a novel variant of
histone Hl. Further, p35 was strongly bound to ribosomal DNA in vitro. The
results of immunoblotting of histones extracted from each tissue of the various
plant species with the nucleolus/​specific antibodies also suggested the
conservation of similar epitope(s) in both mono/​ and dicotyledonous plants. From
these results, it is suggested that similar variants of histone Hl are
specifically distributed in the nucleoli of all plant species and help to
organize the nucleolar chromatin.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 10398848 [PubMed /​ indexed for MEDLINE]

316: Mutat Res. 1999 May 19;426(2):167/​71.

Assessment of the genotoxicity of contaminated soil with the
Allium/Vicia/​micronucleus and the Tradescantia/​micronucleus assays.

Cotelle S, Masfaraud JF, Ferard JF.

Centre des Sciences de l'Environnement, Universite de Metz, B.P. 4025, 57040,
Metz Cedex 1, France.

The present study concerns the genotoxicity of contaminated soil near Metz,
France. Three plant bioassays, the Vicia faba (broad bean), the Allium cepa
(white onion) and the Tradescantia (spiderwort) micronuclei tests were used to
evaluate for genotoxicity. Two soil samples were tested: soil sample A (from an
industrial waste site) and soil sample B (from a cokeworks waste site). Maleic
hydrazide was used as the positive control. Aqueous extracts of the soil samples
were used to treat the roots of Vicia and Allium, and plant cuttings of
Tradescantia according to the standard protocol for these plant assays
established by the International Program on Chemical Safety and the World Health
Organization. The results of these tests showed differential sensitivity in the
three different bioassays. Soil sample A was more toxic than soil sample B.
Copyright 1999 Elsevier Science B.V.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 10350593 [PubMed /​ indexed for MEDLINE]

317: Am J Bot. 1999 May;86(5):609.

Reference standards for determination of DNA content of plant nuclei.

Johnston JS, Bennett MD, Rayburn AL, Galbraith DW, Price HJ.

Departments of Entomology and Soil and Crop Sciences, Texas A&M University,
College Station, Texas 77843 Jodrell Laboratory, Royal Botanic Gardens, Kew,
Richmond, Surrey TW9 3DS, UK Department of Agronomy, University of Illinois,
Urbana, Illinois 61821 Department of Plant Sciences, University of Arizona,
Tucson, Arizona 85721.

Flow cytometry was used to compare 14 potential reference standards for plant
DNA content determination. Both chicken and plant internal standards were used,
as were propidium iodide (PI) and 4'/​6/​diamidino/​2/​phenylindole (DAPI) as
fluorochromes. Means and standard errors of the means are presented for the 14
potential reference standards, and the means are compared to those obtained by
Feulgen densitometry. Five species are recommended as an initial set of
international standards for future plant DNA content determinations: Sorghum
bicolor cv. Pioneer 8695 (2C = 1.74 pg), Pisum sativum cv. Minerva Maple (2C =
9.56 pg), Hordeum vulgare cv. Sultan (2C = 11.12 pg), Vicia faba (2C = 26.66
pg), and Allium cepa cv. Ailsa Craig (2C = 33.55 pg). It is recommended that the
reference standard of choice be one with 2C and 4C nuclear DNA content peaks
similar to, but not overlapping, the 2C and 4C peaks of the target species. We
recommend PI as the fluorochrome of choice for flow cytometric determination of
plant DNA content. DAPI should be used only if the estimated DNA value is
corroborated by using a second stain that has no bias for AT/​ or GC/​rich
sequences within genomes.

PMID: 10330063 [PubMed /​ as supplied by publisher]

318: Genome. 1999 Apr;42(2):343/​50.

Euchromatic domains in plant chromosomes as revealed by H4 histone acetylation
and early DNA replication.

Vyskot B, Siroky J, Hladilova R, Belyaev ND, Turner BM.

Institute of Biophysics, Czech Academy of Sciences, Brno, Czech Republic.
vyskot@ibp.cz

Using specific polyclonal antisera raised against acetylated isoforms of histone
H4, we have analyzed their distribution in the dioecious plant Silene latifolia
(syn. Melandrium album) possessing heteromorphic sex chromosomes. Our previous
studies on this species have shown that one of the two X chromosomes in
homogametic female cells is heavily methylated and late replicating, as a
possible consequence of dosage compensation. Here we report that there are no
detectable differences in intensity and distribution of H4 acetylation between
these two X chromosomes. In S. latifolia only distal/​subtelomeric chromosome
regions, on both the sex chromosomes and autosomes, display strong signals of H4
acetylation at N/​terminal lysines 5, 8, and 12. These acetylated domains
correspond to the very early replicating distal chromosome regions as revealed
by 5/​bromodeoxyuridine pulses followed by the indirect immunofluorescence
microscopy. The distribution of H4 acetylated at lysine 16 was uniform along the
chromosomes. The unique distal/​subtelomeric H4 acetylation signals were also
observed in three other Silene species (S. vulgaris, S. pendula, and S.
chalcedonica), but not in two non/​related plant species tested (Allium cepa and
Nicotiana tobacum). The presented data as well as our recent studies on the
structure of S. latifolia chromosome ends indicate that Silene species possess
the specific distal/​subtelomeric location of euchromatin, gene/​rich regions on
chromosomes.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 10231965 [PubMed /​ indexed for MEDLINE]

319: Exp Cell Res. 1999 Feb 1;246(2):516/​26.

The plant nucleoskeleton: ultrastructural organization and identification of
NuMA homologues in the nuclear matrix and mitotic spindle of plant cells.

Yu W, Moreno Diaz de la Espina S.

Nuclear Matrix Group, Department of Plant Cell and Molecular Biology, Centro de
Investigaciones Biologicas, CSIC, Velazquez 144, Madrid, 28006, Spain.

In the present work we investigate the structural organization of the
nucleoskeleton of Allium cepa meristematic root cells. Resinless sections reveal
for the first time a residual filamentous network in plant nuclei. This network
is composed of branched knobbed filaments with associated globular structures,
connected to the lamina and to the dense aggregates of different sizes. Results
of immunoblotting show that many components of this network are homologues of
intermediate filament/​type proteins. NuMA, a coiled/​coil protein related to
intermediate filaments, found in animal cells, can also be detected in this
plant nuclear matrix system. Immunofluorescence reveals a diffuse distribution
of the animal NuMA homologues in plant nuclear core filaments in interphase.
Resinless immunoelectron microscopy further reveals a distribution along the
extended filaments and the dense aggregates. During mitosis, in contrast to the
accumulation at the poles in animal cells, NuMA homologues in plant onion cells
show a diffuse pattern, which may correspond to the spindle matrix. Our data are
the first report of the conservation in plants of NuMA proteins, which may be
involved in both nuclear and mitotic spindle organizations. Copyright 1999
Academic Press.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9925768 [PubMed /​ indexed for MEDLINE]

320: Chromosome Res. 1998 Nov;6(7):567/​74.

Comparative analysis of crossover exchanges and chiasmata in Allium cepa x
fistulosum after genomic in situ hybridization (GISH).

Stevenson M, Armstrong SJ, Ford/​Lloyd BV, Jones GH.

School of Biological Sciences, The University of Birmingham, Edgbaston, UK.

Genomic in situ hybridization (GISH) successfully differentiated homoeologous
genomes in the inter/​specific hybrid Allium cepa x fistulosum, thus allowing the
detection of reciprocal crossover events as label exchanges in separating
anaphase I chromosomes. Three of the eight chromosome pairs were positively
identified by fluorescence in situ hybridization (FISH) to rDNA sequences. There
was a general similarity of the GISH/​based label exchange frequencies and
metaphase I chiasma frequencies, but with a 20% deficit of chiasmata. Reasons
for this apparent deficit are discussed. The locations of chiasmata and label
exchanges are in broad agreement.

Publication Types:
Comparative Study

PMID: 9886776 [PubMed /​ indexed for MEDLINE]

321: Eur J Cell Biol. 1998 Nov;77(3):247/​52.

Replication of 5 S ribosomal genes precedes the appearance of early nuclear
replication complexes.

Cuadrado A, Pelayo HR, Gimenez/​Abian MI, Jouve N, De la Torre C.

Departamento de Biologia Celular y Genetica, Facultad de Ciencias, Universidad
de Alcala, Alcala de Henares, Spain.

The present work shows that replication of the 5 S ribosomal genes differs in
time and 3'deoxyadenosine sensitivity from replication of other nuclear genes,
in Allium cepa L. root meristems. Fluorescence in situ hybridization with the
pTa794 DNA probe which contains a complete 410 bp 5 S gene from Triticum
aestivum allowed to detect four clusters of 5 S genes in these diploid cells (2n
= 16), two of them in the short arm of the smallest metacentric chromosomal pair
7. Replication of the 5 S ribosomal genes occurred very early in interphase, as
discerned by their resolution as doubled spots only two hours after interphase
was initiated in synchronous binucleate cells. Codetection of nuclear
replication (by immunodetection of 5/​bromo/​2'/​deoxyuridine incorporation) showed
that the replication of the 5 S ribosomal genes occurred before any
incorporation of 5/​bromo/​2'deoxyuridine could be detected in the nuclei. The
earliest Br/​DNA detected in these cells followed a radial pattern from different
foci apparently dispersed along some chromosomal arms. These structures seem to
represent early replication complexes, as a result of the displacement of
multiple DNA forks from the foci known as pre/​replication complexes where the
replication machinery of the earliest replicating genes assembles. No consistent
positional correlation existed between the formation of the early replication
complexes and the already replicated 5 S ribosomal clusters. Finally, nuclear
replication but not that of the 5 S genes was prevented by 3'deoxyadenosine, and
the earliest replicating 5 S ribosomal gene cluster differed in both sister
nuclei resulting from the segregation of one single chromosome in anaphase.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9860141 [PubMed /​ indexed for MEDLINE]

322: Indian J Biochem Biophys. 1998 Aug;35(4):193/​9.

Cell cycle control protein p34cdc2 homologue and its phase specific accumulation
in synchronized onion (Allium cepa L.) root meristem cells.

Chaudhuri SK, Ghosh S.

Centre of Advanced Study in Botany, University of Calcutta, India.

A key regulator of the cell cycle is a highly conserved protein kinase whose
catalytic subunit, p34cdc2, is encoded by cdc2 gene. Immunoblotting with a
polyclonal antibody raised against PSTAIRE sequence (found in the N/​terminal
region of all cdc2 and cdc2 related proteins throughout the phylogenetic scale
including higher plants), was used to study the presence of p34cdc2 in onion
scale leaves and root tip cells. p34cdc2 homologues are beyond the detection
level in scale leaves. PSTAIRE antibody was used to estimate p34cdc2 kinase
protein levels during cell cycle in highly synchronous population of Allium cepa
L. root meristem cells. p34cdc2 kinase protein showed gradual increase in their
levels from S phase to G2 phase boundary. Immunoprecipitation followed by in
vitro histone H1 kinase assays also depicted that its kinase activity increased
parallel to the increase in p34cdc2 level.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9854898 [PubMed /​ indexed for MEDLINE]

323: Mutat Res. 1998 Oct 12;418(2/​3):113/​9.

Genotoxicity testing of wastewater sludge using the Allium cepa
anaphase/​telophase chromosome aberration assay.

Rank J, Nielsen MH.

Department of Environment, Technology and Social Studies, Roskilde University,
PO Box 260, DK/​4000, Roskilde, Denmark. jr@ruc.dk

Wastewater sludges were analysed in the Allium cepa genotoxicity test. They were
sampled during three winter periods from three Danish municipal wastewater
treatment plants differing in size and industrial load. The toxicity of the
sludge was tested in the Allium root inhibition assay, and the results expressed
as EC30 and EC50 values showed that the toxicity could be positive correlated to
the industrial load. However, when genotoxicity was tested at concentrations
corresponding to the EC30 and EC50 values in the A. cepa anaphase/​telophase
assay, only two sludge samples from the smallest plant with the lowest
industrial load induced significant chromosome aberrations. Concentrations of
the heavy metal's Pb, Ni, Cr, Zn, Cu, and Cd were also determined and could
partly be correlated with the toxicity of the sludge and the industrial load of
the treatment plants. Copyright 1998 Elsevier Science B.V.

PMID: 9757013 [PubMed /​ indexed for MEDLINE]

324: Mutat Res. 1998 Jul 8;415(1/​2):47/​57.

The Allium cepa chromosome aberration test reliably measures genotoxicity of
soils of inhabited areas in the Ukraine contaminated by the Chernobyl accident.

Kovalchuk O, Kovalchuk I, Arkhipov A, Telyuk P, Hohn B, Kovalchuk L.

Friedrich Miescher/​Institut, Basel, Switzerland.

The accident on the Chernobyl Nuclear Power Plant reactor IV in April 1986 led
to the release of an enormous amount of radioactive material into the biosphere
and to the formation of a complex pattern of nuclear contamination over a large
area. As a consequence more than 5 million km2 of the soil in the Ukraine became
contaminated with more than 1 Ci/km2 [1,2]. An assessment of the genetic
consequences of the nuclear pollution is one of the most important problems. We
applied the Allium cepa test to estimate the impact on plant chromosomes of
nuclear pollution in the inhabited zones of the Ukraine. We tested soil from the
obligatory resettlement zone (zone 2), where the mean density of pollution is
15/​40 Ci/km2; zones of enhanced radiological control/​zone 3, 5/​15 Ci/km2 and
zone 4, 1/​5 Ci/km2. We found a dose/​dependent increase in the fraction of
aberrant mitoses from control values of 1.6 +//​ 0.9% up to 23.8 +//​ 5.0%, and a
corresponding monotonous decrease of the mitotic index from 49.4 +//​ 4.8% to a
limiting value of 22.5 +//​ 4.0% at pollution levels exceeding 35 Ci/km2
(activity of the soil samples exceeding 6000 Bq/kg, respectively). We observed a
strong, significant correlation of 137Cs activity of soil samples with the
percentage of chromosomal abnormalities, r = 0.97 (P < 0.05), and with the
mitotic index, r = /​0.93 (P < 0.05), in the roots of A. cepa, respectively. The
results showed high toxicity and genotoxicity of radioactively polluted soils
and confirmed the efficiency of the A. cepa test as a quick and inexpensive
biological test for ecological and genetic risk assessment in the 'Chernobyl'
zones.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9711261 [PubMed /​ indexed for MEDLINE]

325: Plant Physiol. 1998 Aug;117(4):1507/​13.

Cloning of sucrose:sucrose 1/​fructosyltransferase from onion and synthesis of
structurally defined fructan molecules from sucrose.

Vijn I, van Dijken A, Luscher M, Bos A, Smeets E, Weisbeek P, Wiemken A,
Smeekens S.

Department of Molecular Cell Biology, University of Utrecht, Padualaan 8, 3584
CH Utrecht, The Netherlands. i.m.c.vijn@bio.uu.nl

Sucrose (Suc):Suc 1/​fructosyltransferase (1/​SST) is the key enzyme in plant
fructan biosynthesis, since it catalyzes de novo fructan synthesis from Suc. We
have cloned 1/​SST from onion (Allium cepa) by screening a cDNA library using
acid invertase from tulip (Tulipa gesneriana) as a probe. Expression assays in
tobacco (Nicotiana plumbaginifolia) protoplasts showed the formation of
1/​kestose from Suc. In addition, an onion acid invertase clone was isolated from
the same cDNA library. Protein extracts of tobacco protoplasts transformed with
this clone showed extensive Suc/​hydrolyzing activity. Conditions that induced
fructan accumulation in onion leaves also induced 1/​SST mRNA accumulation,
whereas the acid invertase mRNA level decreased. Structurally different fructan
molecules could be produced from Suc by a combined incubation of protein extract
of protoplasts transformed with 1/​SST and protein extract of protoplasts
transformed with either the onion fructan:fructan 6G/​fructosyltransferase or the
barley Suc:fructan 6/​fructosyltransferase.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9701606 [PubMed /​ indexed for MEDLINE]

326: Chromosome Res. 1998 Jun;6(4):315/​21.

Terminal heterochromatin and alternative telomeric sequences in Allium cepa.

Pich U, Schubert I.

Institut fur Pflanzengenetik und Kulturpflanzenforschung, Gatersleben, Germany.

The chromosome termini of the onion (Allium cepa) apparently lack
Arabidopsis/​type telomeric repeats. The terminal Giemsa bands of A. cepa
chromosomes contain a 375/​bp satellite and (short arm of chromosome 8)/ or
(short arm of chromosome 6) rDNA repeats. By means of fluorescence in situ
hybridization (FISH) on metaphase chromosomes and on DNA fibres with probes
specific for Ty1/​copia retroelements and a En/Spm/​transposable element/​like
sequence, respectively, it was demonstrated that the former are rarely and the
latter frequently associated with satellite repeats within the terminal
heterochromatin. Polymerase chain reaction of polyC/​tailed nuclear DNA with
anchor primers and single satellite/​specific primers yielded amplification
products that, after cloning and sequencing, revealed satellite sequences. This
supports the idea that satellite repeats represent one class of terminal
sequences in A. cepa.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9688522 [PubMed /​ indexed for MEDLINE]

327: Plant J. 1998 Jun;14(6):743/​50.

Localization of a myosin/​like protein to plasmodesmata.

Radford JE, White RG.

Department of Biological Sciences, Monash University, Clayton, Victoria,
Australia. janine.radford@sci.monash.edu.au

Myosin has been localized to plasmodesmata in root tissues of Allium cepa, Zea
mays and Hordeum vulgare using a polyclonal antibody to animal myosin in both
fluorescence and electron microscopy. Labelling was also observed throughout the
cytoplasm, mainly associated with the endoplasmic reticulum and plasma membrane.
On Western blots, bands of 180 and 110 kDa were consistently labelled in all
three species. These bands were also labelled when the blot was incubated in
actin prior to staining with antibodies to actin, raising the possibility that
either of these proteins (180 kDa or 110 kDa) may be present in plasmodesmata.
Pre/​treatment of the tissue with 2,3/​butanedione monoxime (BDM), an inhibitor of
actin/​myosin motility, resulted in a strong constriction of the neck region of
plasmodesmata. These results indicate that a myosin/​like protein may be present
in plasmodesmata and may also play a role in the regulation of transport at the
neck region.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 9681037 [PubMed /​ indexed for MEDLINE]

328: Exp Cell Res. 1998 Jul 10;242(1):45/​59.

Histones and DNA ultrastructural distribution in plant cell nucleus: a
combination of immunogold and cytochemical methods.

Gonzalez/​Melendi P, Testillano PS, Mena CG, Muller S, Raska I, Risueno MC.

Laboratorio de Organizacion Nuclear en el Desarrollo de Plantas, Centro de
Investigaciones Biologicas, (CSIC), Madrid, Spain.

In this work we report for the first time the ultrastructural distribution of
histones and DNA in the nuclear compartments in two different plant cell types:
Allium cepa L. root meristems and Capsicum annuum L. microspores and pollen
grains, by using antibodies against histones H2B and H4 and anti/​DNA.
Immunolocalizations were combined with ultrastructural cytochemistry for nucleic
acids (methylation/​acetylation method), DNA (NAMA/​Ur) and RNPs (EDTA), to relate
the subcellular location of histones and DNA with the chemical
subcompartmentalization of the cell nucleus. This is particularly interesting
concerning the presence of histones or not on fibers of the interchromatin
region and on the fibrillar components of the nucleolus, nuclear subcompartments
where transcription has been shown to take place at some regions. Our
methodological approach permitted to define precisely the structures where
histones were detected in relation to the ultrastructural localization of
chromatin in various structural condensation levels. Concerning the localization
of DNA and histones on the different components of the nucleolus, the
combination of immunogold labeling with the methylation/​acetylation cytochemical
method, developed in our laboratory, was very useful, thus permitting a clear
recognition of the nucleolar components and a correct assignment of labeling,
which is not always evident on uranyl/​lead/​stained Lowicryl sections. Double
immunogold assays were also done for a simultaneous visualization of histones
and DNA. Our results show a coincident distribution of histones and DNA on the
same nuclear compartments revealing the presence of both antigens on condensed
chromatin, fibers of the interchromatin region, principally located at the
periphery of the condensed chromatin, and in the fibrillar components of the
nucleolus.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9665801 [PubMed /​ indexed for MEDLINE]

329: Biotechniques. 1998 May;24(5):796/​800, 802.

Microsatellite enrichment in organisms with large genomes (Allium cepa L.).

Fischer D, Bachmann K.

Institute of Plant Genetics and Crop Plant Research, Gatersleben, Germany.

To exploit the polymorphism of repeat numbers in short tandem repeat (STR)
sequences (microsatellites) as molecular markers, STRs must be isolated and PCR
primers must be developed in flanking sequences. In species with large genomes
such as Allium cepa L. (onion and shallot), an efficient selection procedure for
genomic fragments containing STRs is a crucial step. Here we describe a
nonradioactive method for microsatellite isolation based on affinity capture of
single/​stranded restriction fragments annealed to biotinylated microsatellite
oligonucleotides (CA)10, (GAA)8 and (AAC)8 followed by adapter/​mediated genomic
PCR. Cloning of the products in E. coli and plasmid sequencing revealed more
than 60% positive clones. Primers were designed in STR/​flanking regions, and one
or two bands were amplified in 13 diploid onion and five shallot accessions.
Allelism of the bands was confirmed by product sequencing.

Publication Types:
Research Support, Non/​U.S. Gov't
Technical Report

PMID: 9591129 [PubMed /​ indexed for MEDLINE]

330: Cell Res. 1998 Mar;8(1):51/​62.

Immunolocalization of actin in intact and DNA/​ and histone/​depleted nuclei and
chromosomes of allium cepa.

Wan LH, Xing M.

Institute of Genetics and Cytology, Northeast Normal University, Changchun,
China.

The presence of actin in eukaryotic nuclei and chromosomes, and especially in
higher plant nuclei and chromosomes, has not been well established. We detected
actin in meristematic cells of Allium cepa with indirect immunofluorescence
technique and observed bright fluorescence in the intact nuclei and chromosomes,
indicating that actin is present in the nuclei and chromosomes of the higher
plant. We labeled sections of the meristematic cells of A. cepa with immunogold
technique, gold particles were found over the whole nuclei and a number of gold
particles were concentrated in condensed chromatin and nucleoli, confirming the
results of the immunofluoresence observations. We treated the nuclei and
chromosomes of A. cepa with DNase I and 2M NaCl and obtained DNA/​ and
histone/​depleted nuclei and chromosomes. Indirect immunofluorescence tests
showed that the DNA/​ and histone/​depleted nuclei and chromosomes reacted
positively with the anti/​actin antibodies. These results demonstrate that actin
exists not only in intact nuclei and chromosomes, but also in DNA/​ and
histone/​depleted nuclei and chromosomes of the plant. In addition, our
immuno/​fluorescence tests indicate that tropomyosin is present in the nuclei and
chromosomes of A. cepa.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9570017 [PubMed /​ indexed for MEDLINE]

331: Environ Mol Mutagen. 1998;31(2):183/​91.

Genotoxic effects of heavy metals: comparative investigation with plant
bioassays.

Steinkellner H, Mun/​Sik K, Helma C, Ecker S, Ma TH, Horak O, Kundi M, Knasmuller
S.

Institute for Tumor Biology/​Cancer Research, University of Vienna, Austria.

The potential use of micronucleus assays in plants for the detection of
genotoxic effects of heavy/​metal ions was investigated. Three different plant
systems were comparatively investigated in micronucleus tests with Tradescantia
pollen mother cells (Trad MCN) and micronucleus tests with meristematic root tip
cells of Allium cepa and Vicia faba (Allium/ Vicia MCN). As3+, Pb2+, Cd2+, Zn2+
caused a dose/​dependent increase of MCN frequencies in all three test systems.
Cu2+ gave consistently negative responses in all three tests; Zn2+ caused only a
moderate, statistically not significant increase of MCN frequencies in Vicia.
The ranking of genotoxic potencies in all three tests was in the descending
order: As3+ > Pb2+ > Cd2+ > Zn2+ Cu2+. In experiments with Tradescantia,
induction of MCN was observed in a concentration range between 1 and 10 mM,
whereas in tests with root tip cells, higher concentrations (10/​1,000 mM) were
required to show significant effects. Further increase of the exposure levels
caused toxic effects (reduction of root growth), cell division delays, and a
decrease of MCN frequencies. Comparisons by linear regression analyses indicated
that the sensitivity of the three bioassays for heavy metals decreases in the
order: Trad MCN > Vicia root MCN > Allium root MCN. In further experimental
series, a soil sample which contained high concentrations of the five metals and
a control soil were investigated. Aqueous soil extracts induced only weak
effects in Trad MCN tests and no effects in the root tip assays, whereas
cultivation of the plants in the soils resulted in a pronounced induction of MCN
in the Tradescantia system and moderate effects in Vicia and Allium. In
conclusion, the results of the study indicate that the Trad MCN assay detects
the genotoxic effects of heavy metals and can be used for biomonitoring
metal/​contaminated soils.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 9544197 [PubMed /​ indexed for MEDLINE]

332: Folia Histochem Cytobiol. 1998;36(1):35/​43.

Cell cycle arrest in antheridial extract/​treated root meristems of Allium cepa
and Melandrium noctiflorum.

Maszewski J, Kazmierczak A, Polit J.

Department of Cytophysiology, University of Lodz, Poland.

Previous results have demonstrated that extracts derived from maturing male sex
organs of Chara tomentosa are capable of inducing profound structural and
functional effects upon M/​phase cells in the primary root meristems of
Melandrium noctiflorum and Allium cepa. Evident changes produced by a putative
factor engaged in morphogenesis of antheridial filaments are manifested by: (1)
significant shortening of chromosomes, (2) decreased mitotic indices, and (3)
altered proportions estimated for the prophase and telophase transit times. The
present image analysis of late G2 phase nuclei in antheridial filaments of C.
tomentosa supports the concepts that progressive changes of their functional
activities correspond closely to the increasing proportion of condensed
chromatin. Cytophotometric measurements of Feulgen/​stained cell nuclei in root
meristems after a prolonged incubation in antheridial extracts revealed that
cells which previously divided asynchronously became preferentially arrested in
G1 (M. noctiflorum) and G2 (A. cepa). The stages at which the cells arrest are
supposed to counterpart restriction checkpoints that prevent the initiation of
DNA synthesis and mitosis. This assumption has been confirmed by
autoradiographic studies using 3H/​thymidine. In terms of the "Principal Control
Points" (PCP) hypothesis, the obtained results suggest that two PCPs regulate
G1/​/​>S and G2/​/​>M transition in a nuclear structure/​dependent and a
species/​specific manner. Although in antheridial extract/​treated roots of both
M. noctiflorum and A. cepa there are only slight changes in the levels of
chromatin condensation, the relative proportions of G1/​ and G2/​arrested cells
and their nuclear density profiles differ, as compared with the control and
carbohydrate/​starved plants.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9527023 [PubMed /​ indexed for MEDLINE]

333: Biochemistry. 1998 Mar 17;37(11):3623/​37.

Solution structure of Ace/​AMP1, a potent antimicrobial protein extracted from
onion seeds. Structural analogies with plant nonspecific lipid transfer
proteins.

Tassin S, Broekaert WF, Marion D, Acland DP, Ptak M, Vovelle F, Sodano P.

Centre de Biophysique Moleculaire (CNRS), Orleans, France.
tassin@cnrs/​orleans.fr

The three/​dimensional solution structure of Ace/​AMP1, an antifungal protein
extracted from onion seeds, was determined using 1H NMR spectroscopy and
molecular modeling. This cationic protein contains 93 amino acid residues and
four disulfide bridges. Its structure was determined from 1260 NOE/​derived
distance restraints and 173 dihedral restraints derived from NOEs and 3JCaHNH
coupling constants. The global fold involves four helical segments connected by
three loops and a C/​terminal tail without regular secondary structures, except
for a 3(10)/​helix turn and a beta/​turn. The most striking feature is the absence
of any continuous cavity running through the whole molecule as found in recently
determined structures of nonspecific transfer proteins extracted from wheat and
maize seeds, although their global folds are very similar. Consistent with the
absence of a cavity in the core of Ace/​AMP1, it was found that this protein, in
contrast to ns/​LTPs, does not bind fluorescently labeled phospholipids in
solution. On the other hand, Ace/​AMP1 is able to interact with phospholipid
membranes as shown by the release of carboxyfluorescein from the lumen of
artificial liposomes and by the induction of alterations in fluorescence
polarization of fluorescently labeled phospholipids embedded in artificial
liposomes.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 9521681 [PubMed /​ indexed for MEDLINE]

334: Plant Mol Biol. 1998 Apr;36(6):821/​31.

The genomic organization of non/​LTR retrotransposons (LINEs) from three Beta
species and five other angiosperms.

Kubis SE, Heslop/​Harrison JS, Desel C, Schmidt T.

Norman Borlaug Institute, DeMontfort University Leicester, Scraptoft, UK.

We have isolated and characterized conserved regions of the reverse
transcriptase gene from non/​LTR retrotransposons, also called long interspersed
nuclear elements (LINEs), from Beta vulgaris, B. lomatogona and B. nana. The
novel elements show strong homology to other non/​LTR retrotransposons from
plants, man and animals. LINEs are present in all species of the genus Beta
tested, but there was variation in copy number. Analysis by Southern
hybridization and fluorescent in situ hybridization revealed the clustered
organization of these retroelements in beet species. PCR amplification using
degenerate primers to conserved motifs of the predicted LINE protein sequence
enabled the cloning of LINEs from both Monocotyledonae (Allium cepa, Oryza
sativa and Secale cereale) and Dicotyledonae (Nicotiana tabacum and Antirrhinum
majus) indicating that LINEs are a universal feature of plant genomes. A
dendrogram of fifteen new and six previously isolated sequences showed the high
level of sequence divergence while revealing families characteristic of some
genera. The genomic organization of non/​LTR retrotransposons was examined more
detailed in A. majus and O. sativa.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9520275 [PubMed /​ indexed for MEDLINE]

335: Gene. 1997 Dec 31;205(1/​2):255/​60.

DNA base composition of Allium genomes with different chromosome numbers.

Ricroch A, Brown SC.

Laboratoire d'Evolution et Systematique, Universite Paris/​Sud, Centre National
de la Recherche Scientifique, URA 2154, Orsay, France. ricroch@esv.u/​psud.fr

The present report examines whether the presence of an additional chromosome can
be detected as modifying the nuclear DNA amount and base composition of the
cell, determined here by flow cytometry of interphasic nuclei, using four
monosomic additions (chromosomes 3C, 4C, 7C and 8C transmitted from Allium cepa
to Allium fistulosum L.). A. cepa differs significantly from A. fistulosum in
genome size (2C DNA = 33.2 pg in A. cepa and 23.3 pg in A. fistulosum) as well
as in GC content (38.7% and 39.8%, respectively). The presence of an extra
chromosome of A. cepa obviously increases the nuclear DNA amount above the A.
fistulosum value but also alters the apparent mean GC content. By comparing the
monosomic additions and the parental background, the DNA amount and base
composition of each of the four single chromosomes were calculated to quantify
the GC content per chromosome and therefore to deduce their initial contribution
to the A. cepa genome. Taken individually, some chromosomes are atypical in
terms of GC content: the single chromosome 3C is AT/​rich, having only about only
25% GC. However, the three other chromosomes examined are typical of the A. cepa
genome in base composition. Indeed, this biological panel gives access to
chromosomal features via a cytometric assay of nuclei. It should facilitate
quantification of GC/​rich repetitive sequences forming heterochromatic domains
located mainly at the telomeres in the monocotyledonous A. cepa genome.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9461399 [PubMed /​ indexed for MEDLINE]

336: Biotech Histochem. 1997 Nov;72(6):304/​14.

Microspectrophotometric analysis of accumulation of the fluorones K/​fluorescein,
rose Bengal and phloxine red in living plant cells.

Tsekos I, Platis F, Tsekos V.

Institute of Botany, Aristotle University of Thessaloniki, Macedonia, Greece.

Spectrophotometric investigations of dye solutions in different media and of
living stained cells from the upper epidermis of the scaleleaf of Allium cepa
were carried out with the dyes K/​fluorescein, rose Bengal and phloxine red to
elucidate the mechanism of the accumulation of these dyes in the cytoplasm, the
nucleus and the cell sap. Thin layer chromatography and paper electrophoresis
indicate that the K/​fluorescein used here contains no detectable contaminants.
Besides the main component, rose Bengal contains two components in small
quantities with Rf values of 0.64 and 0.57, plus three more components in
traces. Besides the two main components (Rf values of 0.83 and 0.73), phloxine
red also contains five more components in traces. Electrophoretic investigations
reveal that in aqueous solution the fluorones rose Bengal and phloxine red from
pH 2.0/​11 show a migration toward the anode. K/​fluorescein from pH 2.9/​10.4
shows a migration toward the anode, but at pH 1.9 a migration toward the
cathode. By shaking aqueous solutions of K/​fluorescein, rose Bengal and phloxine
red at different pH values with different organic solvents, the above used
stainings show different spectral absorption curves according to the polarity of
the solvent. The position of the absorption maxima and the shape of the
absorption curves of these three anionic dyes lead to the conclusion that the
staining of the living cytoplasm and nucleus is due to ion accumulation by means
of the "ion trap mechanism" within the aqueous phase of the cytoplasm (cytosol)
and the nucleus. Adsorption of dye particles in the protein phase of the
cytoplasm cannot be excluded. There seems to be a fundamental difference in the
vital staining of the protoplasm by anionic and cationic dyes, the latter
apparently accumulating as neutral dye molecules in the lipid phase of the
protoplasm. The concentration of the dyes used in the living cytoplasm (cytosol)
is approximately 0.2/​0.05%. During natural and artificial displacement of
K/​fluorescein from the cytoplasm to the vacuole, it appears that accumulation of
the dye within the vacuole is performed through an ion trap mechanism in the
form of bivalent ions. Along with natural displacement, it is possible that ion
accumulation also occurs in metabolic products.

PMID: 9453676 [PubMed /​ indexed for MEDLINE]

337: Genetika. 1997 Sep;33(9):1310/​2.

[Genotoxic effects of tonarol]

[Article in Russian]

Karamova NS, Il'inskaia ON, Ivanchenko OB, Ermolaev AI, Gil'mutdinov GZ,
Gershanov FB, Khamitov BR.

Genotoxic effects of 2,6/​di/​tret/​butyl/​4/​methylphenol (tonarol) were studied
using four test systems: the Ames test, the SOS chromotest, the cytogenetic test
with rootlets of onion (Allium cepa), and the in vivo micronucleus test. Tonarol
did not affect gene mutation induction in Salmonella typhimurium tester strains,
the SOS response in the Escherichia coli strain PQ37, chromosomal aberrations in
cells of onion (Allium cepa) rootlets, and micronuclei in erythrocytes of
peripheral blood of CBA x C5713 L/G mice. Tonarol induced cell division in A.

Publication Types:
English Abstract

PMID: 9445825 [PubMed /​ indexed for MEDLINE]

338: Planta. 1998 Jan;204(1):37/​43.

The positional control of mitosis and cytokinesis in higher/​plant cells.

Gimenez/​Abian MI, Utrilla L, Canovas JL, Gimenez/​Martin G, Navarrete MH, De la
Torre C.

Centro de Investigaciones Biologicas, CSIC, Madrid, Spain.

The present work establishes a correlation between cell length and patterns of
mitotic microtubular assemblies in Allium cepa L. root meristems. Binucleate
cells were formed by a short caffeine treatment which aborted the formation of
the phragmoplast during telophase. The largest binucleate cells (about 50
microns in length) behaved as two contiguous mononucleate cells in their next
mitosis: they developed two preprophase bands (PPBs), one around each nucleus,
where two spindles and two phragmoplasts were subsequently formed. On the other
hand, the shortest binucleate cells (about 36 microns in length) formed a single
PPB at the site of the aborted phragmoplast and, in the medium/​sized cells
(about 44 microns) in which the single PPB formed around the nucleus possessing
the largest cytoplasmic environment, the two mitotic spindles and the new
phragmoplasts moved to, or were assembled in the position of the phragmoplast
that had been aborted one cycle earlier. Some rules derive from these
observations. First of all, the aborted phragmoplast left a signal for
microtubule positioning which was still operative one cycle later, in two/​thirds
of the bimitoses. Also, that formation of the PPB is dispensable. Moreover, its
development does not always predict the future division plane, because of the
presence of competing old signals which are stronger than those shed by the PPB
in the same mitosis, but which fade away with distance. Finally, the positional
signals were reinforced when the ratio of monomeric to fibrillar actin was
increased by cytochalasin D during their shedding. When this drug was given
simultaneously with caffeine, the frequency of bimitoses which, one cycle later,
developed spindles and phragmoplasts in the positions of the old phragmoplast
increased. On the other hand, those frequencies dropped in relation to control
when the cytochalasin D treatment took place during bimitosis, indicating that
at this time the treatment reinforced the signals produced in bimitosis itself.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9443383 [PubMed /​ indexed for MEDLINE]

339: Eur J Cell Biol. 1997 Nov;74(3):289/​93.

Frailty of two cell cycle checkpoints which prevent entry into mitosis and
progression through early mitotic stages in higher plant cells.

del Campo A, Gimenez/​Martin G, Lopez/​Saez JF, de la Torre C.

Departamento de Biologia, Facultad de Ciencias, Universidad del Zulia,
Maracaibo/Venezuela.

Allium cepa L. root meristems were given two short caffeine treatments spaced by
15 hours, the time which roughly corresponds to the duration of one cell cycle.
In this way two subsequent cytokineses were prevented, and multinucleate cells
with their in complement distributed into two, three or four nuclei were formed.
Though all nuclei started to replicate synchronously in these cells, some of
them (fast nuclei) completed their replication earlier than others (slow
nuclei). The present report shows that two successive checkpoints operate before
prometaphase in these cells. The first one prevents the entry of the fast nuclei
into prophase until the slow ones have completed their replication. The second
checkpoint ensures the synchronous entry into prometaphase after all nuclei have
reached and finished prophase. By treating the multinucleate cells with an
inhibitor of DNA synthesis at that time when fast but not slow nuclei had
finished their replication, it was observed that both checkpoint mechanisms
became leaky with time. Under these conditions the fast nuclei entered prophase
in the presence of nuclei which were prevented from finishing the replication of
their DNA. Subsequently, even prometaphase was triggered after a prolonged
prophase. Finally, as expected from the presence of mitotic stages in these
cells, nuclei with incompletely replicated DNA endured premature chromosome
condensation. The prematurely condensed chromosomes either remained in a
prometaphase/​like stage until reconstitution nuclei formed or they followed the
progression of the fast nuclei into metaphase and anaphase leading to the
appearance of acentric chromosomal segments which after reconstitution gave rise
to aneuploid nuclei containing unstable and broken DNA.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9402477 [PubMed /​ indexed for MEDLINE]

340: Mutat Res. 1997 Oct 24;393(3):215/​22.

Differential induction of adaptive responses by paraquat and hydrogen peroxide
against the genotoxicity of methyl mercuric chloride, maleic hydrazide and ethyl
methane sulfonate in plant cells in vivo.

Patra J, Panda KK, Panda BB.

Department of Botany, Berhampur University, Orissa, India.

Induction of adaptive response by conditioning doses of paraquat (PQ) and
hydrogen peroxide (H2O2) in embryonic shoot cells of Hordeum vulgare and root
meristem cells of Allium cepa was tested against the genotoxicity of challenge
doses of methyl mercuric chloride (MMCl), maleic hydrazide (MH) or ethylmethane
sulfonate (EMS). Plant tissue fixed at different recovery hours following the
challenge treatments was analysed for cells with genotoxicity markers that
include spindle or chromosome aberrations and micronuclei. The results provided
clear/​cut evidence that whereas H2O2 induced adaptive response for the
chromosome damage caused by MMCl and MH, PQ induced the same for MMCl and EMS,
but not for damage caused by MH. The findings pointed to the differences in the
underlying mechanisms of oxidative responses induced by H2O2 and O2/​.

Publication Types:
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 9393614 [PubMed /​ indexed for MEDLINE]

341: J Nihon Univ Sch Dent. 1997 Sep;39(3):136/​41.

Anti/​bacterial action of onion (Allium cepa L.) extracts against oral pathogenic
bacteria.

Kim JH.

Yongin University, Kyunggi/​do, Republic of Koria.

In this study, the focus was on the antibacterial activity of onions. This study
researched the activities of onion extracts on Streptococcus mutans and
Streptococcus sobrinus, the main causal bacteria for dental caries, and
Porphyromonas gingivalis and Prevotella intermedia, considered to be the main
causal bacteria of adult periodontitis. The results showed that the onion
extracts possess an effect on all test bacterial strains (S.mutans JC/​2, S.
sobrinus OMZ176, P. gingivalis ATCC 33277 and P. intermedia ATCC 25611), and the
effects were bactericidal against cultured and resting bacterial cells. The
activity of the onion extracts was stable even after 48 hours in the culture
medium. This result suggests that no decomposition or volatility of onion
extracts occurred in the culture medium. The antibacterial activity of onion
extracts was not markedly influenced by cysteine (10 mM) treatment. However,
activity significantly decreased with alkali treatment. Grated onion left to
stand at 37 degrees C for 48 hours did not show antibacterial activity. Also,
activity of steam treated (100 degrees C, 10 min.) onion was not observed. Using
avicel plate by thin layer chromatography with the solvent of n/​butanol:acetic
acid:water (3:3:1), the main component of the substance (the substance which
develops color with ninhydrin) was observed at an Rf value of about 0.9.

PMID: 9354029 [PubMed /​ indexed for MEDLINE]

342: Mutagenesis. 1997 Jul;12(4):265/​9.

Genotoxicity of tetrodotoxin from puffer fish tested in root meristem cells of
Allium cepa L.

Khora SS, Panda KK, Panda BB.

Department of Marine Sciences, Berhampur University, Orissa, India.

Tetrodotoxin (TTX) extracted and purified from puffer fish Arothron
nigropunctatus was tested for genotoxicity employing the root meristem cells of
Allium cepa as the assay system. The genotoxicity endpoints investigated were
mitotic index (MI), meta/​anaphases with spindle aberrations, interphases with
micronuclei (MNC) and sister chromatid exchanges (SCE) in metaphase chromosomes.
The results demonstrated that TTX inhibited mitosis at concentrations of > or =
30 microM as evident by the fall of MI, but failed to induce MNC at significant
levels at any of the concentrations tested (10/​100 microM). TTX was thus proved
to be neither clastogenic nor aneugenic in the present study. It was, however,
noteworthy that TTX at far lower concentrations, 0.1/​5.0 microM, significantly
enhanced the frequencies of SCE which indicated possible interference of the
toxin in DNA replication and repair.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9237772 [PubMed /​ indexed for MEDLINE]

343: Mutat Res. 1997 Apr 24;390(1/​2):121/​7.

Allium cepa anaphase/​telophase root tip chromosome aberration assay on
N/​methyl/​N/​nitrosourea, maleic hydrazide, sodium azide, and ethyl
methanesulfonate.

Rank J, Nielsen MH.

Department of Environment, Technology and Social Studies, Roskilde University,
Denmark. jr@teksam.ruc.dk

The Allium anaphase/​telophase assay was used to show genotoxicity of
N/​methyl/​N/​nitrosourea (MNU), maleic hydrazide (MH), sodium azide (NaN3) and
ethyl methanesulfonate (EMS). All agents induced chromosome aberrations at
statistically significant levels. The rank of the lowest doses with positive
effect was as follows: NaN3 0.3 mg/l < MH 1 mg/l < MNU 41 mg/l < EMS 100 mg/l.
The results were compared with results from other plant assays (Arabidopsis,
Vicia, Tradescantia) and for MH and MNU the values were found to be within the
same range, whereas the results in the Allium test for NaN3 and EMS were in a
lower range than that found for the other plant assays. EMS and MMS (methyl
methanesulfonate), two chemicals used as positive controls in mutagenicity
testing, were compared in the Allium test, and MMS was found to be about ten
times more potent in inducing chromosome aberrations than EMS. Recording of
micronuclei in interphase cells showed that this endpoint does not give more
information of clastogenicity than recording of chromosome aberrations in
anaphase/​telophase cells.

Publication Types:
Comparative Study

PMID: 9150760 [PubMed /​ indexed for MEDLINE]

344: Arch Biochem Biophys. 1997 Apr 15;340(2):159/​67.

Cell type and spatial location dependence of cytoplasmic viscosity measured by
time/​resolved fluorescence microscopy.

Srivastava A, Krishnamoorthy G.

Chemical Physics Group, Tata Institute of Fundamental Research, Mumbai, India.

Information on the cell type and spatial location dependence of cytoplasmic
viscosity would be very useful in understanding some of the processes occurring
in the cell. For this purpose, fluorescent dye kiton red (sulforhodamine B) was
loaded into a variety of cells such as Swiss 3T3 fibroblasts, human mononuclear
cells, Sarcoma/​180 tumor cells, Chinese hamster ovary cells, plant cells from
Digitalis lanata, stamen hair cells of Tradescantia, and guard mother cells of
Allium cepa. Space/​resolved measurements of cytoplasmic viscosity were carried
out by using an experimental set/​up wherein a picosecond laser system was
coupled with an epifluorescence microscope. The spatial resolution of this
set/​up was approximately 1.0 micron, and reliable dynamic fluorescence
measurements could be obtained from 10(2) to 10(3) fluorescent molecules.
Fluorescence lifetime measurements showed that a large fraction (approximately
70%) of kiton red was in the free form. Fluorescence anisotropy decay of kiton
red in cells was analyzed by a two population (free and bound) model. The
microviscosity of cytoplasm was estimated from the anisotropy decay kinetics of
the free probe. It was found that the cytoplasmic viscosity is dependent on both
the cell type and spatial location within a cell. Furthermore, both the average
value of viscosity and spatial variation within a cell were larger in the plant
cells when compared to the animal cells. Model studies in various simpler
systems have shown that the higher viscosity observed in some part of the cell
could be due to either physical restriction and/or the presence of high
concentrations of small solutes and macromolecules.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9143317 [PubMed /​ indexed for MEDLINE]

345: Mutat Res. 1997 Mar 17;389(2/​3):271/​7.

A fast comet assay variant for solid tissue cells. The assessment of DNA damage
in higher plants.

Navarrete MH, Carrera P, de Miguel M, de la Torre C.

Departamento de Biologia, Universidad Autonoma de Madrid, Canto Blanco, Spain.
navarret@ccuam3.sdi.uam.es

The single/​cell gel electrophoresis or comet assay, under high alkaline
conditions, detects low levels of DNA damage. In it, broken DNA migrates from
the nucleus to the anode providing images similar to comets. To adapt this assay
to solid tissue cells, nuclei were directly obtained from Allium cepa L. roots.
The surface of each single fresh sharply cut meristem was exposed to a small
drop of 50 mM Sorensen buffer at pH 6.8, placed on a regular agarose/​coated
slide. By immediately adding low melting point agarose at 30 degrees C, nuclei
resulted embedded in agarose. A final layer of this agarose ended the
preparative steps. Conventionaly prepared leukocytes were used as a control. The
treatment with detergent (lysis step of the conventional assay) proved to be
unnecessary for the nude nuclei. A 20 min/​long electrophoresis (at 0.65 V. cm/​1,
230 mA and 10 degrees C) was more sensitive than a 10 min/​long one for detecting
the differential response of plant nuclei to 2 and 4 Gy of gamma/​irradiation. A
short fixation in methanol transformed the preparations into semi/​permanent
ones, without altering their later DNA staining by ethidium bromide. The use of
instantaneously isolated nuclei simplifies and expands the use of this technique
to any eukaryotic cell from solid tissues.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9093393 [PubMed /​ indexed for MEDLINE]

346: Mutat Res. 1997 Mar 17;389(2/​3):129/​39.

Persistence of cadmium/​induced adaptive response to genotoxicity of maleic
hydrazide and methyl mercuric chloride in root meristem cells of Allium cepa L.:
differential inhibition by cycloheximide and buthionine sulfoximine.

Panda KK, Patra J, Panda BB.

Department of Botany, Berhampur University, Orissa, India.

With an objective to determine the period of persistence of the metal/​induced
adaptive response to chemical mutagens and heavy metals, growing root meristems
of Allium cepa were conditioned by cadmium sulfate (CdSO4), 4 x 10(/​7) and 4 x
10(/​6) M for 1 h and subsequently challenged by maleic hydrazide (MH), 5 x
10(/​3) M or methyl mercuric chloride (MMCl), 1.26 x 10(/​6) M for 3 h at
different time intervals ranging from a few minutes to several hours following
the conditioning dose. Root meristems, fixed at regular intervals during
recovery from 6 to 48 h, were cytologically analysed for cells with micronuclei
(MNC). The adaptive responses to MH and MMCl were observed as early as 5 min
after the Cd/​conditioning that persisted for at least 48 h. Metabolic
inhibitors, cycloheximide (CH). 10(/​7) M and buthionine sulfoximine (BSO),
10(/​4) M administered either prior to or simultaneous with Cd/​conditioning
effectively prevented the adaptive response to MH. Whereas BSO, an inhibitor of
phytochelatin synthesis, prevented the adaptive responses from 15 min to 8 h
after the conditioning dose, CH an inhibitor of cytoplasmic protein synthesis
prevented the same from 6 to 48 h. The findings underscored the differential
roles of phytochelatins and proteins underlying the foregone metallo/​adaptive
response.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9093376 [PubMed /​ indexed for MEDLINE]

347: Anal Biochem. 1997 Mar 15;246(2):195/​204.

Analysis of fructans from higher plants by matrix/​assisted laser
desorption/ionization mass spectrometry.

Stahl B, Linos A, Karas M, Hillenkamp F, Steup M.

Institute for Medical Physics and Biophysics, University of Muenster, Germany.

In this communication both matrix/​assisted laser desorption/ionization mass
spectrometry (MALDI/​MS) and high/​performance anion/​exchange chromatography
(HPAEC) have been applied to analyze fructans from higher plants. Size
distribution of a commercially available fructan preparation from Dahlia
variabilis L. was determined by MALDI/​MS. Molecular masses ranged from 2,000 up
to 6,000 Da with a peak value of distribution at 2,635 Da. Essentially the same
pattern was obtained using HPAEC. Low/​molecular/​weight fructans from onion bulbs
(Allium cepa L.) were studied in more detail. Tissue extracts were analyzed by
MALDI/​MS without any analyte purification. Mass/​spectra of both proteins and
oligosaccharides were obtained. For identification, metastable ion scanning was
performed. Neither deproteinization nor deionization of the samples affected the
oligosaccharide pattern. Using HPAEC, a more complex oligosaccharide pattern was
obtained because isomeric glycans were differentiated. However, the overall size
distribution was similar to that obtained by MALDI/​MS. In further experiments
epidermal or parenchyma cell layers of the onion bulb were placed into matrix
solution and were then subjected to MALDI/​MS and metastable ion scanning as
well. By taking this approach, analyte desorption was achieved immediately from
plant tissue. Oligosaccharide mass spectra were essentially the same as those of
the extracts. To our knowledge, this is the first time that MALDI/​MS has been
applied as a microprobe to plant tissue. Finally MALDI/​MS analysis was performed
using single/​cell extracts from onion tissues without any purification of the
analyte.

PMID: 9073356 [PubMed /​ indexed for MEDLINE]

348: Cell Biol Int. 1997 Mar;21(3):159/​66.

Monoclonal antibody raised against human mitotic cyclin B1, identifies cyclin
B/​like mitotic proteins in synchronized onion (Allium cepa L.) root meristem.

Chaudhuri SK, Ghosh S.

Centre of Advanced Study in Botany, University of Calcutta, India.

Cyclin B/​like mitotic proteins have been detected in synchronized Allium cepa L.
root tip cells by using mouse monoclonal anti/​cyclin B1 antibody raised against
human cyclin B1. Immunoblot shows two closely placed isoforms of cyclin B/​like
proteins having an apparent molecular weight around 54 kDa. In vivo
[35S]/​methionine labelling followed by immunoprecipitation and autoradiography
indicates that cyclin B/​like proteins are mainly synthesized in the G2 phase of
the cell cycle and destroyed in late mitosis. Immunoblotting data depict that
the level of cyclin B/​like proteins reaches the maximum at the late G2 to early
M phase; and it becomes degraded in the late hours of mitosis. Moreover, the
cyclin B isoforms are stabilized in colchicine/​arrested metaphase cells as
already reported in animal cells.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9151992 [PubMed /​ indexed for MEDLINE]

349: Plant J. 1997 Mar;11(3):387/​98.

Fructan of the inulin neoseries is synthesized in transgenic chicory plants
(Cichorium intybus L.) harbouring onion (Allium cepa L.) fructan:fructan
6G/​fructosyltransferase.

Vijn I, van Dijken A, Sprenger N, van Dun K, Weisbeek P, Wiemken A, Smeekens S.

Department of Molecular Cell Biology, University of Utrecht, The Netherlands.

Fructan (polyfructosylsucrose) is an important storage carbohydrate in many
plant families. fructan:fructan 6G/​fructosyltransferase (6G/​FFT) is a key enzyme
in the formation of the inulin neoseries, a type of fructan accumulated by
members of the Liliales. We have cloned the 6G/​FFT from onion by screening a
cDNA library using barley sucrose:fructan 6/​fructosyltransferase (6/​SFT) as a
probe. The deduced amino acid sequence showed a high homology with plant
invertases and 6/​SFT. Incubation of protein extracts from transgenic tobacco
plants with the trisaccharide 1/​kestose and sucrose resulted in the formation of
neokestose and fructans of the inulin neoseries with a degree of polymerization
up to six. Introduction of the onion 6G/​FFT into chicory resulted in the
synthesis of fructan of the inulin neoseries, in addition to the synthesis of
linear inulin.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 9107030 [PubMed /​ indexed for MEDLINE]

350: Cell Prolif. 1997 Feb;30(2):61/​9.

Default cycle phases determined after modifying discrete DNA sequences in plant
cells.

Sans J, Leyton C, Gimenez/​Abian MI, Gimenez/​Abian JF, Aller P, De la Torre C.

Instituto de Ciencias Biomedicas, Facultad de Medicina, Universidad de Chile,
Santiago, Chile.

After bromosubstituting DNA sequences replicated in the first, second, or third
part of the S phase, in Allium cepa L. meristematic cells, radiation at 313 nm
wavelength under anoxia allowed ascription of different sequences to both the
positive and negative regulation of some cycle phase transitions. The present
report shows that the radiation forced cells in late G1 phase to advance into S,
while those in G2 remained in G2 and cells in prophase returned to G2 when both
sets of sequences involved in the positive and negative controls were
bromosubstituted and later irradiated. In this way, not only G2 but also the S
phase behaved as cycle phases where cells accumulated by default when signals of
different sign functionally cancelled out. The treatment did not halt the rates
of replication or transcription of plant bromosubstituted DNA. The irradiation
under hypoxia apparently prevents the binding of regulatory proteins to Br/​DNA.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9332496 [PubMed /​ indexed for MEDLINE]

351: Arch Environ Contam Toxicol. 1997 Feb;32(2):166/​71.

Application of plant and earthworm bioassays to evaluate remediation of a
lead/​contaminated soil.

Chang LW, Meier JR, Smith MK.

Ecological Exposure Research Division, National Exposure Research Laboratory,
U.S. Environmental Protection Agency, 26 W. Martin Luther King Drive,
Cincinnati, Ohio 45268, USA.

Earthworm acute toxicity, plant seed germination/rootelongation (SG/RE) and
plant genotoxicity bioassays were employed to evaluatethe remediation of a
lead/​contaminated soil. The remediation involved removalof heavy metals by a
soil washing/soil leaching treatment process. A portionof the soil after
remediation was rinsed with water in order to simulateexposure to rainfall. The
bioassay results showed that the soils beforetreatment (BT) and after treatment
plus water rinsing (RT) were not toxic toearthworms in a 14/​day exposure, while
after treatment (AT) showedsignificant toxicity. The LC50 values for Eisenia
fetida andLumbricus terrestris were 44.04 and 28.83 (as % AT soilsupplemented in
artificial soil), respectively. The phytotoxicity dataindicated that all three
test soils significantly inhibited lettuce SG/RE ina dose/​related manner, with
AT being the most phytotoxic. In oats, RT had noeffect on SG/RE and AT was more
toxic than BT. For the two local site grassseeds tested (blue grama and sideoat
grama), the AT soil was the mostphytotoxic followed by BT and RT. In Allium cepa
(common onion), BTand AT induced similar levels of genetic damage to root tip
cells, whereas RTwas not genotoxic. High salt levels generated during the
remediation processappeared to be responsible for the increased toxicity of AT
soil for bothplants and earthworms. The rinsing of the AT soil with water
effectivelyremoved both acutely toxic and genotoxic components of the soil.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9069192 [PubMed /​ indexed for MEDLINE]

352: Folia Histochem Cytobiol. 1997;35(4):227/​30.

Extract from maturing antheridia of Chara induces increased condensation of
mitotic chromosomes in root meristem cells.

Maszewski J.

Department of Cytophysiology, University of Lodz, Poland.

Serving as the incubation medium for root meristems of Allium cepa and
Melandrium noctiflorum, crude extracts obtained from maturing male sex organs of
Chara tomentosa induce: (1) increased condensation (with both shortening and
thickening) of prophase, metaphase and anaphase chromosomes, (2) disarrangement
of metaphase plates and aberrant segregation of chromosomes during anaphase, and
(3) abnormal decondensation of chromosomes at telophase. Numerous resemblances
that exist between the natural processes occurring in male sex organs of Chara
and root meristem cells from antheridial extract/​treated seedlings suggest the
existence of a diffusible condensation/​promoting factor, responsible for the
reorganization of chromatin.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9619423 [PubMed /​ indexed for MEDLINE]

353: Cytobios. 1997;90(362/​363):171/​4.

Effect of Peganum harmala extract on root tips of Allium cepa.

Abderrahman SM.

Department of Biological Sciences, The Hashemite University, Zarqa, Jordan.

Treatment with Peganum harmala extract remarkably increased the mitotic index in
Allium cepa root tips with increasing treatment duration at all exposure times
used and with almost all concentrations. The extract caused a relatively high
increase in the mitotic index after a long period of treatment with some low
concentrations.

PMID: 9547064 [PubMed /​ indexed for MEDLINE]

354: Genetica. 1997;100(1/​3):205/​17.

The Ty1/​copia group of retrotransposons in plants: genomic organisation,
evolution, and use as molecular markers.

Kumar A, Pearce SR, McLean K, Harrison G, Heslop/​Harrison JS, Waugh R, Flavell
AJ.

Scottish Crop Research Institute, Scotland, UK.

The genomic organisation and diversity of the Ty1/​copia group retrotransposons
has been investigated in several crop plants and their relatives from both
dicotyledonous and monocotyledonous families, including potato (Solanum
tuberosum), faba beans (Vicia faba), Vicia melanops, Vicia sativa, barley
(Hordeum vulgare), rye (Secale cereale), and onion (Allium cepa). Extreme
heterogeneity in the sequence of the Ty1/​copia retrotransposons from all these
plants was revealed following sequence analysis of reverse transcriptase
fragments. The estimated copy numbers of the Ty1/​copia group retrotransposons
for the genomes of S. tuberosum, L. esculentum, A. cepa, S. cereale, and V. faba
is highly variable, ranging from a few hundred to approximately a million copies
per genome. In situ hybridisation data from metaphase and prophase chromosomes
of V. faba, S. cereale, and H. vulgare suggest that retrotransposon sequences
are dispersed throughout the euchromatic regions of the genome but are almost
undetectable in most heterochromatic regions. In contrast, similar data from
metaphase chromosomes of A. cepa suggests that although retrotransposon
sequences are dispersed throughout the euchromatic regions of the genome, they
are predominantly concentrated in the terminal heterochromatin. These results
are discussed in the context of the role played by the Ty1/​copia group
retrotransposons in the evolution of the plant genome. Lastly, the application
of retrotransposon sequences as genetic markers for mapping genomes and for
studying genetic biodiversity in plants is presented.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9440274 [PubMed /​ indexed for MEDLINE]

355: Planta. 1997;203(3):349/​61.

Are the characteristics of betanidin glucosyltransferases from cell/​suspension
cultures of Dorotheanthus bellidiformis indicative of their phylogenetic
relationship with flavonoid glucosyltransferases?

Vogt T, Zimmermann E, Grimm R, Meyer M, Strack D.

Institut fur Pflanzcnbiochemie (IPB), Abteilung Sekundarstoffwechsel, Halle,
Saale, Germany.

Uridine 5'/​diphosphoglucose:betanidin 5/​O/​ and 6/​O/​glucosyltransferases (5/​GT
and 6/​GT; EC 2.4.1) catalyze the regiospecific formation of betanin (betanidin
5/​O/​beta/​glucoside) and gomphrenin I (betanidin 6/​O/​beta/​glucoside),
respectively. Both enzymes were purified to near homogeneity from
cell/​suspension cultures of Dorotheanthus bellidiformis, the 5/​GT by classical
chromatographic techniques and the 6/​GT by affinity dye/​ligand chromatography
using UDP/​glucose as eluent. Data obtained with highly purified enzymes indicate
that 5/​GT and 6/​GT catalyze the indiscriminate transfer of glucose from
UDP/​glucose to hydroxyl groups of betanidin, flavonols, anthocyanidins and
flavones, but discriminate between individual hydroxyl groups of the respective
acceptor compounds. The 5/​GT catalyzes the transfer of glucose to the C/​4'
hydroxyl group of quercetin as its best substrate, and the 6/​GT to the C/​3
hydroxyl group of cyanidin as its best substrate. Both enzymes also catalyze the
formation of the respective 7/​O/​glucosides, but to a minor extent. Although the
enzymes were not isolated to homogeneity, chromatographic, electrophoretic and
kinetic properties proved that the respective enzyme activities were based on
the presence of single enzymes, i.e. 5/​GT and 6/​GT. The N terminus of the 6/​GT
revealed high sequence identity to a proposed UDP/​glucose: flavonol
3/​O/​glucosyltransferase (UF3GT) of Manihot esculenta. In addition to the 5/​GT
and 6/​GT, we isolated a UF3GT from D. bellidiformis cell cultures that
preferentially accepted myricetin and quercetin, but was inactive with
betanidin. The same result was obtained with a UF3GT from Antirrhinum majus and
a flavonol 4'/​O/​glucosyltransferase from Allium cepa. Based on these results,
the main question to be addressed reads: Are the characteristics of the 5/​GT and
6/​GT indicative of their phylogenetic relationship with flavonoid
glucosyltransferases?

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9431682 [PubMed /​ indexed for MEDLINE]

356: Fold Des. 1997;2(3):183/​92.

Homology modelling of an antimicrobial protein, Ace/​AMP1, from lipid transfer
protein structures.

Gomar J, Sodano P, Ptak M, Vovelle F.

Centre de Biophysique Moleculaire, Orleans, France.

BACKGROUND: Plant nonspecific lipid transfer proteins (ns/​LTPs) are small basic
proteins that facilitate lipid shuttling between membranes in vitro. The
function of ns/​LTPs in vivo is still unknown. It has been suggested, in relation
to their lipid binding ability, that they may be involved in cutin formation.
Alternatively, they may act in the plant defence system against pathogenic
agents. Ace/​AMP1 is an antimicrobial protein extracted from onion seed that
shows sequence homology with ns/​LTPs but that is unable to transfer lipids. We
have recently determined the three/​dimensional structure of wheat and maize
ns/​LTPs. In order to compare the structural features of Ace/​AMP1 and ns/​LTPs, we
have used the comparative modelling software MODELLER to predict the structure
of Ace/​AMP1. RESULTS: The global fold of Ace/​AMP1 is very similar to those of
ns/​LTPs, involving four helices and a C/​terminal tail without secondary
structure elements. The structure of maize and wheat ns/​LTP is characterized by
the existence of a tunnel/​like hydrophobic cavity in which a lipid molecule can
be inserted. In the Ace/​AMP1 structure, this cavity is blocked by a number of
bulky residues. Similarly, the electrostatic potential contours of ns/​LTPs show
some common features that were not observed in Ace/​AMP1. CONCLUSIONS: Although
Ace/​AMP1 displays a similar global fold to ns/​LTPs, it does not present a
hydrophobic cavity, which may explain why Ace/​AMP1 cannot shuttle lipids between
membranes in vitro. The large differences in the electrostatic properties of
Ace/​AMP1 and ns/​LTPs suggest a different mode of interaction with membranes.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 9218956 [PubMed /​ indexed for MEDLINE]

357: Yi Chuan Xue Bao. 1997;24(1):50/​3.

[On the effect of Chinese lacquer upon the cell division of root tip of Allium
cepa]

[Article in Chinese]

Xing H, Liang W.

Department of biology, Northwest University, Lanzhou.

Chinese Lacquer, as a fine coating, has been studied and applied for thousands
years. The allergic reaction in Chinese Lacquer on the human skin has also been
known early. The reaction of Chinese Lacquer on mitosis of cell in plant
meristem have not been reported yet and was carefully studied in this paper. The
result showed that Chinese Lacquer induced severe abnormality of mitotic
division in Allium cepa root tips. This was more obvious in the anaphase and
telophase, especially in the former phase laggard chromosomes, chromosome
bridges, acentric fragments and polypolar distribution could be seen frequently.
A lot of polynuclear bodies were observed in the telophase. Therefore, we think
that the Chinese Lacquer can be used as a plant cell mutagen, and suggest
geneticists and physiologists to do more researches on the effects of Chinese
Lacquer at the genetic variation, metabolism etc.

Publication Types:
English Abstract

PMID: 9167366 [PubMed /​ indexed for MEDLINE]

358: Planta. 1997;201(4):487/​95.

NopA64, a novel nucleolar phosphoprotein from proliferating onion cells, sharing
immunological determinants with mammalian nucleolin.

de Carcer G, Cerdido A, Medina FJ.

Centro de Investigaciones Biologicas (CSIC), Madrid, Spain.

Five major soluble nuclear proteins associated with cell proliferation were
identified in Allium cepa L. root cells. One of them, of 64 kDa, was revealed by
Western blotting with anti/​mammalian nucleolin antibodies. A polyclonal antibody
raised against this protein, which we have named NopA64, localised it in the
nucleolus as well as in nuclear coiled bodies. Together with NopA64, the
antibody also revealed a smaller form, called NopA61. Both proteins were present
in the soluble ribonucleoprotein fraction and in the nuclear matrix of
proliferating cells, but NopA61 was the only form revealed in differentiated
cells. NopA64 contained epitopes also present in other plants, in mammalian
nucleolin and in its yeast homologue, gar2. In mammals, the highest homology was
with 50/​kDa nucleolin fragments containing the RNA/​binding motifs and the
glycine/​arginine/​rich (GAR) domain. NopA64 was moderately phosphorylated in
vitro by exogenous casein kinase II and cdc2 kinase, whereas NopA61 was highly
phosphorylated by casein kinase II. Furthermore, NopA61 was the only band
detected after dephosphorylation as well as after endoproteolysis of NopA64.
This protein could be one of the various functional homologues of mammalian
nucleolin in plant cells.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9151450 [PubMed /​ indexed for MEDLINE]

359: Plant Mol Biol. 1997 Jan;33(1):11/​21.

Comparative analysis of the chromosomal and genomic organization of
Ty1/​copia/​like retrotransposons in pteridophytes, gymnosperms and angiosperms.

Brandes A, Heslop/​Harrison JS, Kamm A, Kubis S, Doudrick RL, Schmidt T.

Karyobiology Group, Department of Cell Biology, John Innes Centre, Norwich, UK.

We have investigated the physical distribution of the reverse transcriptase
genes of Ty1/​copia/​like retrotransposable elements from 12 plant species
belonging to different subdivisions by hybridization in situ on chromosome
preparations. Ty1/​copia/​like elements showed different and non/​random
hybridization patterns. A dispersed distribution throughout most of the
chromosomes with reduced hybridization at some regions or with some weak
clustering at other regions was found in Allium cepa, Beta vulgaris, Brassica
campestris, Brassica oleracea, Pennisetum glaucum, Pinus elliottii, Selaginella
apoda, Vicia faba and Vicia narbonensis. Reduced hybridization occurred mainly
at centromeric regions, nucleolus/​organizing regions and regions known to be
mainly composed of tandemly repeated sequences. In the fern Pteris cretica the
retroelements showed a dispersed genomic organization with clustering at some
chromosomal regions and whole chromosomes showing little signal. In Arabidopsis
thaliana and Cicer arietinum Ty1/​copia/​like elements were found in clusters at
the paracentromeric heterochromatin, a novel organization for a repetitive
element in A. thaliana. New retroelement families were isolated from A. thaliana
and from Beta vulgaris. Alignment of the deduced peptide sequences with
Ty1/​copia/​like elements from other plants showed considerable divergence which
was used to calculate their relationships, indicating the value of reverse
transcriptase gene analysis in phylogenetic and biodiversity studies.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 9037155 [PubMed /​ indexed for MEDLINE]

360: Eur J Cell Biol. 1997 Jan;72(1):9/​12.

Competence for nuclear replication and the NOR/​chromosomes of Allium cepa L.

Panzera F, Gimenez/​Abian MI, Lopez/​Saez JF, Gimenez/​Martin G, Cuadrado A,
Canovas JL, De la Torre C.

Centro de Investigaciones Biologicas, CSIC, Madrid, Spain.

Autotetraploid (4n = 32) cells were induced in Allium cepa L. root meristems by
successively treating with a multipolarizing agent in anaphase (carbetamide) and
an inhibitor of cell plate formation in telophase (caffeine). This treatment
produced cells with their 32 chromosomes distributed in more than two nuclei.
During G1, one of the nuclei in the resulting trinucleate cells had a DNA
content which was equivalent to an average of 16 chromosomes, while the other 16
chromosomes were randomly distributed in two aneuploid nuclei. In the set of 16
chromosomes forming the onion diploid complement, there are 4 NOR/​chromosomes
and 5 chromosomes carrying DNA domains providing a nucleus with the competence
to replicate, as previously shown. Expected probabilities derived from the
different possible models for cosegregation of both kinds of chromosomes in the
two aneuploid nuclei of the trinucleate cells were estimated by a computer
simulation. These expected values were compared with the recorded frequencies of
aneuploid nuclei which were able to organize a nucleolus and to respond to
inducers of replication. The present data are compatible with the existence of
sequences providing a nucleus with the competence to replicate in three out of
the four NOR/​bearing chromosomes, as well as in two other chromosomes of this
diploid complement. The scarcity of chromosomes bearing early origins able to
initiate replication in a nucleus is a striking feature of this huge onion
genome.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 9013720 [PubMed /​ indexed for MEDLINE]

361: Plant Physiol. 1996 Nov;112(3):1119/​1125.

Role of Apoplastic and Cell/​Wall Peroxidases on the Stimulation of Root
Elongation by Ascorbate.

Cordoba/​Pedregosa M, Gonzalez/​Reyes JA, Canadillas M, Navas P, Cordoba F.

Departamento de Biologia Celular, Facultad de Ciencias, Universidad de Cordoba,
Cordoba, Spain.

Elongation of onion (Allium cepa L.) roots was highly stimulated by ascorbate
(ASC) and its natural precursor I/​galactone/​[gamma]/​lactone (GL). When
incubation media were supplemented with lycorine (Lyc), an inhibitor of the ASC
biosynthesis, root growth was negligible even in the presence of ASC or GL. ASC
completely inhibited in vitro guaiacol peroxidase activities that were isolated
from both the apoplast and the cell wall. However, ferulic/​acid/​dependent
peroxidase from the cell wall was partially inhibited by ASC, whereas ferulic
acid peroxidase activity from the apoplastic fluid was completely inhibited by
ASC as long as ASC was present in the assay medium. ASC content in cells was
increased by preincubations with ASC or GL, whereas Lyc reduced it. On the other
hand, ASC or GL treatments decreased both apoplast and cell/​wall/​bound
peroxidase activities, whereas Lyc had a slight stimulating effect. These
results are discussed on the basis of a possible control of root elongation by
ASC via its action on peroxidases that are involved in the regulation of
cell/​wall extensibility.

PMID: 12226436 [PubMed /​ as supplied by publisher]

362: Int J Food Sci Nutr. 1996 Nov;47(6):455/​68.

Nutrient composition and nutritional importance of green leaves and wild food
resources in an agricultural district, Koutiala, in southern Mali.

Nordeide MB, Hatloy A, Folling M, Lied E, Oshaug A.

Nordic School of Nutrition, University of Oslo, Norway.

This paper discusses the nutrient composition and the nutritional importance of
green leaves and wild gathered foods in an area with surplus food production in
Mali. In this West African country, there is little information about the
nutrient composition and the nutritional quality of foods in general, and of
wild gathered foods in particular. Food frequency was collected in two
cross/​sectional surveys. Focus group discussions with women in the area were
used to collect information about seasonality, availability and preparation of
various foods. Selected food samples were collected for chemical analysis of
nutrient composition. The food samples of green leaves (Adansonia digitata,
Amaranthus viridis, Tamarindus indica, Allium cepa), seeds and flour (Parkia
biglobosa) and fruits (Tamarindus indica) were analysed for water, energy, fat,
protein, minerals, amino acids and carotenoids. Availability and use of the
foods varied with seasons. In the rainy season, wild gathered foods (e.g. A.
digitata) were used as much as fresh cultivated foods (e.g., A. viridis and A.
cepa). The wild food resources were more frequently used in rural than in urban
areas, with A. digitata as the dominating green leaves. Green leaves were rich
in energy, protein and minerals (calcium, iron). Leaves of A. viridis were, in
particular, rich in beta/​carotene (3290 micrograms/100 g). Chemical score in
dried green leaves varied from 47 (A. cepa) to 81 (A. digitata), with lysine as
the first limiting amino acid. P. biglobosa fermented seeds, with 35% fat and
37% protein were a complementary source of lysine in the diet. Based on the
seasonality, the frequency of use and the nutrient contents of selected green
leaves and wild gathered foods in Koutiala district, it is concluded that these
traditional and locally produced foods are valuable and important nutrient
contributors in the diet both in rural and urban areas, but most important in
rural areas.

PMID: 8933199 [PubMed /​ indexed for MEDLINE]

363: Thromb Haemost. 1996 Sep;76(3):450/​2.

Antiplatelet activity in onion (Allium cepa) is sulfur dependent.

Goldman IL, Kopelberg M, Debaene JE, Schwartz BS.

Department of Horticulture, University of Wisconsin/​Madison 53706, USA.

Plants of the genus Allium such as onion and garlic are often consumed as a
source of compounds which inhibit human platelet activity, with the goal of
decreasing vascular disease. Antiplatelet activity in these plants is determined
in part by native concentrations of organosulfur compounds. Evaluation of four
onion genotypes grown in a field study at four US locations in 1994 demonstrated
onions with mild flavor and low sulfur content exhibited significantly lower
antiplatelet activity than those containing high levels of sulfur. Antiplatelet
activity was significantly positively correlated with genotypically determined
bulb sulfur content and dissolved solids, indicating these latter factors are
good predictors of antiplatelet strength. These data demonstrate antiplatelet
activity is genotype dependent and correlated with bulb sulfur content. Genotype
and bulb sulfur content should be taken into account in studies assessing onion
antiplatelet effects.

Publication Types:
Research Support, U.S. Gov't, Non/​P.H.S.
Research Support, U.S. Gov't, P.H.S.

PMID: 8883285 [PubMed /​ indexed for MEDLINE]

364: Chromosome Res. 1996 Aug;4(5):357/​64.

The Ty1/​copia group retrotransposons of Allium cepa are distributed throughout
the chromosomes but are enriched in the terminal heterochromatin.

Pearce SR, Pich U, Harrison G, Flavell AJ, Heslop/​Harrison JS, Schubert I, Kumar
A.

Cell and Molecular Genetics Department, Scottish Crop Research Institute,
Invergowrie, Dundee, UK.

The genomic organization and diversity of the Ty1/​copia group retrotransposons
has been investigated in a monocotyledonous plant, Allium cepa. We used the
polymerase chain reaction (PCR) to generate sequences corresponding to a
conserved domain of the reverse transcriptase gene of Ty1/​copia retrotransposons
in this plant. Sequence analysis of 27 of these PCR products shows that they are
a highly heterogeneous population, a feature which is common in plants but not
in yeast and Drosophila. Slot/​blot analysis shows there are 100,000/​200,000
copies of Ty1/​copia group retrotransposons within the A. cepa genome (2C = 31.7
pg), indicating that they are a significant component of the genome of this
plant. In situ hybridization to metaphase chromosomes reveals that Ty1/​copia
retrotransposons are distributed throughout the euchromatin of all chromosomes
of A. cepa but are enriched in the terminal heterochromatic regions, which
contain tandem arrays of satellite sequences. This is the first clear evidence
for the presence of Ty1/​copia retrotransposons in the terminal heterochromatin
of plants and contrasts with the distribution of these elements in other plant
species.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 8871824 [PubMed /​ indexed for MEDLINE]

365: Mutat Res. 1996 Jul 5;368(3/​4):171/​9.

The evaluation of waste, surface and ground water quality using the Allium test
procedure.

Smaka/​Kincl V, Stegnar P, Lovka M, Toman MJ.

Public Services Administration, Department of Environmental Protection, Maribor,
Slovenia.

The bulbs of Allium cepa were grown in test liquids of various pollution levels
as follows: undiluted industrial and municipal waste water; biological treatment
plant output water; water from the Drava river upstream and downstream of the
city of Maribor; and non/​chlorinated drinking water as a negative control test.
The paper presents the response of the Allium cepa genetic material to the
presence of potential cytotoxic and genotoxic substances in test liquids and the
suitability of the Allium cepa testing procedure as a method for short/​term
determination of water pollution level. The suitability of the Allium test
procedure as a system for environmental monitoring is presented. The influence
of water pollution on macroscopic and cytologic parameters of the common onion
by application of the biological testing method was examined. The macroscopic
parameter was inhibition of root growth. The cytological parameters were:
aberrant cells in metaphase and anaphase, index of micronuclei appearance and
inhibition of cell division. The possibility of categorization the different
polluted test liquids into quality classes is presented according to the
influence of the test liquids on macroscopic and cytologic parameters. Test
liquids are divided into 8 quality classes: the first class is the least
polluted surface waters, the second and the third classes are more polluted
surface water, the fourth and the fifth classes are biological treatment plant
output waters, the sixth till the eighth quality classes are untreated waste
waters. The most polluted test liquids (untreated industrial and municipal waste
waters) caused sublethal and even lethal effects. The most polluted tested
liquids cause the inhibition of root growth over 50% (even up to 74%), decrease
of mitotic index over 36% (even up to 66%), increase of presence of interphase
cells with micronuclei over 3% and increase of presence of aberrant cells for
more than 10 times in comparison to control test.

PMID: 8692223 [PubMed /​ indexed for MEDLINE]

366: Indian J Exp Biol. 1996 Jul;34(7):634/​40.

Therapeutic values of onion (Allium cepa L.) and garlic (Allium sativum L.).

Augusti KT.

Department of Biochemistry, University of Kerala, India.

Onion and garlic contain many sulfur containing active principles mainly in the
form of cysteine derivatives, viz. S/​alkyl cysteine sulfoxides which decompose
into a variety of thiosulfinates and polysulfides by the action of an enzyme
allinase on extraction. Decomposed products are volatile and present in the oils
of onion and garlic. They possess antidiabetic, antibiotic,
hypocholesterolaemic, fibrinolytic and various other biological actions. In
addition to free sulfoxides in alliums, there are nonvolatile sulfur/​containing
peptides and proteins which possess various activities and thus make these
vegetables as an important source of therapeutic agents. As allyl and related
sulfoxides are inhibiting thiol group enzymes, alliums are to be used only in
limited quantities.

Publication Types:
Review

PMID: 8979497 [PubMed /​ indexed for MEDLINE]

367: Chromosoma. 1996 Jul;105(1):12/​9.

Nucleolar organizer expression in Allium cepa L. chromosomes.

Panzera F, Gimenez/​Abian MI, Lopez/​Saez JF, Gimenez/​Martin G, Cuadrado A, Shaw
PJ, Beven AF, Canovas JL, De la Torre C.

Centro de Investigaciones Biologicas, CSIC, Velazquez 144, E/​28006 Madrid,
Spain.

Roots from Allium cepa L. (cv. Francesa) bulbs in which a maximum of two
nucleoli per nucleus developed were selected for this study. Five rDNA clusters
were detected by fluorescent in situ hybridization on chromosomal squashes (2n =
16) with a rhodamine/​labelled wheat rDNA repeat. The rDNA clusters were located
on four chromosomes: the largest cluster occurred on the small arm of a single
homologue of the smallest pair 8. Its homologue showed two different small rDNA
clusters, one near each telomere. The two homologues of the satellited
chromosomes 6 also showed different rDNA contents, which were intermediate to
those found in pair 8. The same five well/​differentiated hybridization signals
were observed in interphase cells that were inactive in transcription because
they were in dormant roots, or in proliferating ones in which the synthesis of
the large rRNA precursor was prevented. After multipolarizing agent was applied
in anaphase followed by inhibition of cytokinesis, multinucleate autotetraploid
cells were formed, which often contained more than four nucleoli. Thus, at least
two of the three nucleolar organizer regions that consistently failed to develop
a nucleolus in normal mononucleate cells were capable of developing nucleoli
when segregated into different nuclei in multinucleate cells.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 8662254 [PubMed /​ indexed for MEDLINE]

368: Prostaglandins Leukot Essent Fatty Acids. 1996 Mar;54(3):183/​6.

An evaluation of garlic and onion as antithrombotic agents.

Bordia T, Mohammed N, Thomson M, Ali M.

Department of Biochemistry, Faculty of Science, Kuwait University, 13060 Safat,
Kuwait.

Garlic (Allium sativum) and onion (Allium cepa) have been evaluated as possible
antithrombotic agents. Rats were given aqueous extracts of garlic and onion,
orally or intraperitoneally, daily for a period of 4 weeks after which the rats
were sacrificed. The blood was collected from the heart without anticoagulant
and the serum was prepared. The level of thromboxane B2 (TXB2) in the serum was
measured by radioimmunoassay. TXB2 levels in serum of rats treated with the low
dose of aqueous extract of garlic (50 mg/kg) was significantly inhibited
regardless of the mode of administration (orally or intraperitoneally). At the
high dose of garlic and onion (500 mg/kg), a further decrease of TXB2 levels in
the serum of the rats was observed. Boiled garlic and onion at high
concentration (500 mg/ kg) had very little effect on TXB2 synthesis. This shows
that garlic and onion should be consumed in a raw rather than cooked form in
order to achieve a beneficial effect. Boiling of these plants may cause the
decomposition of the potential antithrombotic ingredient present in these herbs.
Garlic was found to be more potent than onion in lowering the TXB2 levels. A
high dose of garlic and onion produces toxicity in the rats (unpublished
observation). These results show that garlic and onion can be taken frequently
in low doses without any side effects, and can still produce a significant
antithrombotic effect.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 8860105 [PubMed /​ indexed for MEDLINE]

369: Chromosome Res. 1996 Feb;4(2):141/​6.

Distribution of 5/​methylcytosine/​rich regions in the metaphase chromosomes of
Vicia faba.

Frediani M, Giraldi E, Castiglione MR.

Dipartimento di Agrobiologia e Agrochimica, Universita della Tuscia, Viterbo,
Italy. ortobot@vm.cnuce.cnr.it

The DNA methylation pattern of Vicia faba metaphase chromosomes was examined
with a specific monoclonal antibody. 5/​methylcytosine (5/​mC) residues are
present in different chromosomal sites, and are particularly abundant in
telomeric and/or subtelomeric regions and in certain intercalary bands.
Chromosomal localization of methylated regions enables a better knowledge of the
lengthwise differentiation of this chromosome complement. Our results also
indicate that there may be differences in monoclonal antibody binding between
corresponding regions of homologous chromosomes in V. faba. This behaviour is
detectable in specific regions with different frequencies. The data support
results previously obtained for Allium cepa metaphase chromosomes using the same
monoclonal antibody.

PMID: 8785608 [PubMed /​ indexed for MEDLINE]

370: Cytobios. 1996;87(350):161/​8.

Mitotic effects of the aqueous leaf extract of Cymbopogon citratus in Allium
cepa root tips.

Williams GO, Omoh LE.

Department of Biological Sciences, University of Lagos, Nigeria.

Aqueous extracts of the lemon grass, Cymbopogon citratus, were used to clear the
malaria parasite in infected mice, although they died some days later. Allium
cepa roots grown in aqueous extracts from 3, 6, 12 and 20 g of chopped leaves
for 1, 3, and 6 h, showed some mitotic abnormalities including c/​mitotic and
mitodepressive effects. The abnormalities were not peculiar to any concentration
or duration of extract treatment. The highest frequency of affected cells was
0.75% in the treatment with the 20 g concentration, but the 3 h treatment group
had the greatest variety of effects. The mitodepressive effect of the extract
increased significantly with concentration and time, and persisted even after 24
h in tap water. The chromosomal effects of the extract occur at a very low
frequency but the mitodepressive effects may have implications for man.

PMID: 9172394 [PubMed /​ indexed for MEDLINE]

371: Bull Environ Contam Toxicol. 1995 Nov;55(5):779/​87.

Effects of Mg2+, Co2+, and Hg2+ on the nucleus and nucleolus in root tip cells
of Allium cepa.

Liu D, Zhai L, Jiang W, Wang W.

Department of Biology, Tianjin Normal University, Republic of China.

Publication Types:
Comparative Study

PMID: 8563214 [PubMed /​ indexed for MEDLINE]

372: J Allergy Clin Immunol. 1995 Nov;96(5 Pt 1):690/​3.

Allium cepa seeds: a new occupational allergen.

Navarro JA, del Pozo MD, Gastaminza G, Moneo I, Audicana MT, Fernandez de Corres
L.

Servicio de Alergologia, Hospital Santiago Apostol, Vitoria/​Gasteiz, Spain.

Publication Types:
Case Reports
Research Support, Non/​U.S. Gov't

PMID: 7499687 [PubMed /​ indexed for MEDLINE]

373: Plant Physiol. 1995 Oct;109(2):445/​55.

A potent antimicrobial protein from onion seeds showing sequence homology to
plant lipid transfer proteins.

Cammue BP, Thevissen K, Hendriks M, Eggermont K, Goderis IJ, Proost P, Van Damme
J, Osborn RW, Guerbette F, Kader JC, et al.

F.A. Janssens Laboratory of Genetics, Katholieke Universiteit Leuven, Heverlee,
Belgium.

An antimicrobial protein of about 10 kD, called Ace/​AMP1, was isolated from
onion (Allium cepa L.) seeds. Based on the near/​complete amino acid sequence of
this protein, oligonucleotides were designed for polymerase chain reaction/​based
cloning of the corresponding cDNA. The mature protein is homologous to plant
nonspecific lipid transfer proteins (nsLTPs), but it shares only 76% of the
residues that are conserved among all known plant nsLTPs and is unusually rich
in arginine. Ace/​AMP1 inhibits all 12 tested plant pathogenic fungi at
concentrations below 10 micrograms mL/​1. Its antifungal activity is either not
at all or is weakly affected by the presence of different cations at
concentrations approximating physiological ionic strength conditions. Ace/​AMP1
is also active on two Gram/​positive bacteria but is apparently not toxic for
Gram/​negative bacteria and cultured human cells. In contrast to nsLTPs such as
those isolated from radish or maize seeds, Ace/​AMP1 was unable to transfer
phospholipids from liposomes to mitochondria. On the other hand, lipid transfer
proteins from wheat and maize seeds showed little or no antimicrobial activity,
whereas the radish lipid transfer protein displayed antifungal activity only in
media with low cation concentrations. The relevance of these findings with
regard to the function of nsLTPs is discussed.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 7480341 [PubMed /​ indexed for MEDLINE]

374: Biotech Histochem. 1995 Sep;70(5):263/​6.

Novel fixation of plant tissue, staining through paraffin with alcian blue and
hematoxylin, and improved slide preparation.

Graham ET, Joshi PA.

Department of Ornamental Horticulture, University of Tennessee, Knoxville
37901/​1071, USA.

Onion (Allium cepa) root tips were fixed in a proprietary solution without
aldehyde, toxic metals or acetic acid. Fixed specimens were embedded in
paraffin, sectioned on a rotary microtome and mounted on detergent/​washed slides
without adhesive. Slides with ribbon segments affixed were immersed in 0.2%
aqueous alcian blue 8GX in screw/​capped Coplin jars in a water bath at 50 C for
1 hr. Excess alcian blue was rinsed off under cold running tap water and the
slides were immersed in quick/​mixed hematoxylin at room temperature for 15 min.
Stained slides were deparaffinized, rinsed with isopropanol, air dried, and
coverslips were affixed with resin. Thus, the traditional paraffin
microtechnique has been modified at all steps from fixation to finishing slides
with coverslips.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 8580211 [PubMed /​ indexed for MEDLINE]

375: Cell Prolif. 1995 Sep;28(9):481/​96.

Impaired chromosome segregation in plant anaphase after moderate hypomethylation
of DNA.

Leyton C, Mergudich D, de la Torre C, Sans J.

Departamento de Biologia Celular y Genetica, Facultad de Medicina, Universidad
de Chile, Santiago, Chile.

10(/​6) M and 10(/​5) M 5/​azacytidine, demethylated around 9% and 17% of the
5/​methylcytosine residues found in Allium cepa L. native DNA, respectively. Both
treatments stimulated RNA synthesis in the cells of root meristems. On the other
hand, the 10(/​5) M treatment gave rise to multiple chromosomal anomalies in
mitosis before any fall in the mitotic index was detectable, but no chromosomal
breaks were ever seen. Serious lesions involved in chromatids and segregation in
anaphase were preferentially found after hypomethylation of DNA sequences
replicated in the second half of the previous S period: (i) sister telomeres
remained unresolved at the cell equator while kinetochores had reached the
poles, (ii) whole unsegregated chromosomes were pulled to one of the poles by
obviously disfunctional kinetochores, resulting in an unbalanced distribution of
chromatids, (iii) unsegregated chromosomes in other cells remained at the
spindle equator as if kinetochores were nonfunctional, while cytoplasmic
division took place before their migration to the poles. Frequently, a growing
cytokinetic plate randomly cut the unsegregated chromosomes, giving rise to
aneuploid nuclei. These anaphase failures are a firm basis to explain why the
10(/​5) M treatment selectively depressed the rate of cell proliferation in these
cells in the long run. On the other hand, if hypomethylation occurred at the
first half of the previous S period, enlarged chromosomal segments were evident
in most metaphases, while chromosome laggards and bridges were recorded in
anaphase at rather similar frequencies after the different 5/​azacytidine
treatments. These data were consistently obtained both in the native
mononucleate cells of meristems and in one subpopulation of synchronous cells
labelled as binucleate by 5 mM caffeine.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 7578598 [PubMed /​ indexed for MEDLINE]

376: J Ethnopharmacol. 1995 Aug 11;48(1):25/​32.

Anti/​hyperglycemic effect of some edible plants.

Roman/​Ramos R, Flores/​Saenz JL, Alarcon/​Aguilar FJ.

Department of Health Sciences, Metropolitan Autonomous University, Mexico, D.F.,
Mexico.

The anti/​hyperglycemic effect of 12 edible plants was studied on 27 healthy
rabbits, submitted weekly to subcutaneous glucose tolerance tests after gastric
administration of water, tolbutamide or a traditional preparation of the plant.
Tolbutamide, Cucurbita ficifolia, Phaseolus vulgaris, Opuntia streptacantha,
Spinacea oleracea, Cucumis sativus and Cuminum cyminum decrease significantly
the area under the glucose tolerance curve and the hyperglycemic peak. Brassica
oleracea var. botrytis, Allium cepa and Allium sativum only decrease the
hyperglycemic peak. The glycemic decreases caused by Psidium guajava, Brassica
oleracea and Lactuca sativa var. romana were not significant (P > .05). The
integration of a menu that includes the edible plants with hypoglycemic activity
for the control and prevention of diabetes mellitus may be possible and
recommendable.

PMID: 8569244 [PubMed /​ indexed for MEDLINE]

377: Planta Med. 1995 Aug;61(4):356/​7.

Anti/​diabetic effects of onion and garlic sulfoxide amino acids in rats.

Sheela CG, Kumud K, Augusti KT.

On oral administration of onion (Allium cepa L.) and garlic (A. sativum L.)
sulfoxide amino acids viz., S/​methylcysteine sulfoxide (SMCS) and
S/​allylcysteine sulfoxide (SACS) to alloxan/​diabetic rats for a month, their
diabetic condition, being characterized by glucose intolerance, weight loss,
depletion of liver glycogen, etc., was ameliorated as comparable to rats treated
with glibenclamide and insulin. However, only the last two drugs significantly
increased the conversion of labelled acetate to liver cholesterol which
indicates a deterrent effect of the allium products against the synthesis of a
risk factor.

Publication Types:
Letter
Research Support, Non/​U.S. Gov't

PMID: 7480182 [PubMed /​ indexed for MEDLINE]

378: Microbiol Res. 1995 May;150(2):167/​72.

Antibacterial, antidermatophytic and antitoxigenic activities of onion (Allium
cepa L.) oil.

Zohri AN, Abdel/​Gawad K, Saber S.

Botany Department, Faculty of Science, Assiut University, Egypt.

The inhibitory effect of onion oil against the growth of various isolates of
bacteria representing Gram/​positive (4 isolates) and Gram/​negative (4 isolates)
species were studied. Results show that onion oil was highly active against all
Gram/​positive bacteria tested and only one isolate (Klebsiella pneumoniae) of
Gram/​negative bacteria. The inhibitory effect of onion oil against nine
different species of dermatophytic fungi were also studied. Onion oil (200 ppm)
completely inhibited the growth of Microsporum canis, M. gypseum and
Trichophyton simii while the growth of both, Chrysosporium queenslandicum and
Trichophyton mentagrophytes was completely inhibited by 500 ppm of onion oil.
The growth of four other species of dermatophytic fungi was gradually reduced by
increasing the concentrations of onion oil. The inhibitory effect of onion oil
was also tested against four toxigenic isolates of fungi. Onion oil at different
concentrations (100, 200 and 500 ppm) tested gradually reduced fungal growth and
aflatoxin production by Aspergillus flavus IMI 89,717 and A. parasiticus var.
globosus IMI 120,920. Fungal growth and production of sterigmatocystin and
rubratoxin A by A. versicolor IMI 16,139 and Penicillium rubrum IMI 136,127 were
completely inhibited by the addition of 200 ppm onion oil.

PMID: 7600010 [PubMed /​ indexed for MEDLINE]

379: Mech Ageing Dev. 1995 Apr 21;80(1):35/​42.

Brassinolide is a selective ribosomal cistron regulator in onion leaf base
tissue.

Karagiannis CS, Pappelis AJ, Yopp JH.

Department of Plant Biology, Southern Illinois University at Carbondale 62901,
USA.

Outer epidermal cells from the basal, equatorial, near/​apical, and apical
regions of the third turgid onion (Allium cepa L. var. yellow, sweet Spanish)
leaf base were treated (3 and 6 h in the dark = T3 and T6, respectively) with
brassinolide (Br, a brassinosteroid plant growth regulator; effects on excised
pieces compared with those in water controls: there were no statistical
differences between the T3 and T6 results). Br induced increases in the volume
and changes in morphologies of the major nucleoli to a greater extent than
observed for major nucleoli in basal through near/​apical controls. No major
nucleoli were activated in control or Br/​treated apical tissue. Minor nucleolar
organizer regions in control and Br/​treated tissue remained inactive in all
locations. We propose that Br is a major ribosomal cistron regulator.

PMID: 7564559 [PubMed /​ indexed for MEDLINE]

380: Mutat Res. 1995 Apr;334(2):185/​95.

The improved Allium/Vicia root tip micronucleus assay for clastogenicity of
environmental pollutants.

Ma TH, Xu Z, Xu C, McConnell H, Rabago EV, Arreola GA, Zhang H.

Department of Biological Sciences, Western Illinois University, Macomb 61455,
USA.

The meristematic mitotic cells of plant roots are appropriate and efficient
cytogenetic materials for the detection of clastogenicity of environmental
pollutants, especially for in situ monitoring of water contaminants. Among
several cytological endpoints in these fast dividing cells, such as
chromosome/chromatid aberrations, sister/​chromatid exchanges and micronuclei,
the most effective and simplest indicator of cytological damage is micronucleus
formation. Although the Allium cepa and Vicia faba root meristem micronucleus
assays (Allium/Vicia root MCN) have been used in clastogenicity studies about 12
times by various authors in the last 25 years, there is no report on the
comparison of the efficiency of these two plant systems and in different cell
populations (meristem and F1) of the root tip as well as under adequate recovery
duration. In order to maximize the efficiency of these bioassays, the current
study was designed to compare the Allium and the Vicia root MCN assays on the
basis of chromosome length, peak sensitivity of the mitotic cells, and the
regions of the root tip where the MCN are formed. The total length of the 2n
complement of Allium chromosomes is 14.4 microns and the total length of the 2n
complement of Vicia is 9.32 microns. The peak sensitivity determined by serial
fixation at 12/​h intervals after 100 R of X/​irradiation is 44 h. The slope of
the X/​ray dose/​response curve of Allium roots derived from the meristematic
regions was lower than that derived from cells in the F1 region. Higher
efficiency was also demonstrated when the MCN frequencies were scored from the
F1 cells in both Allium and Vicia treated with formaldehyde (FA), mitomycin C
(MMC), and maleic hydrazide (MH). The results indicated that scoring of MCN
frequencies from the F1 cell region of the root tip was more efficient than
scoring from the meristematic region. The X/​ray linear regression dose/​response
curves were established in both Allium and Vicia cell systems and the
coefficients of correlations, slope values were used to verify the reliability
and efficiency of these two plant cell systems. Based on the dose/​response slope
value of 0.894 for Allium and 0.643 for Vicia, the Allium root MCN was a more
efficient test system. The greater sensitivity of the Allium roots is probably
due to the greater total length of the diploid complement and the higher number
of metacentric chromosomes.(ABSTRACT TRUNCATED AT 400 WORDS)

Publication Types:
Comparative Study

PMID: 7885371 [PubMed /​ indexed for MEDLINE]

381: Hindustan Antibiot Bull. 1995 Feb/​Nov;37(1/​4):44/​7.

Antibiotics and garlic clove extract/​/​inhibitory agents of cell wall degrading
enzymes.

Alice D, Sivaprakasam K.

Department of Plant Pathology, Agricultural College and Research Institute,
Madurai, India.

Four antibiotics were tested against Erwinia causing soft rot of onion (Allium
cepa var. aggregatum) of which streptomycin sulphate 90% and tetracycline
hydrochloride 10% (streptocycline) recorded the maximum inhibition zone of 27.66
mm. In the enzyme studies the maximum inhibition of pectinlyase (PL),
polygalacturonase (PG) and protopectinase production was recorded by the same
antibiotic. The antibiotics have a significant influence on the production and
activity of cell wall degrading enzymes produced by the plant pathogenic
microorganisms. Garlic clove extract was equally effective in inhibiting the
growth and enzyme production.

PMID: 8972140 [PubMed /​ indexed for MEDLINE]

382: Indian J Biochem Biophys. 1995 Feb;32(1):49/​54.

Erratum in:
Indian J Biochem Biophys 1995 Apr;32(2):111.

Antidiabetic and hypolipidemic effects of S/​methyl cysteine sulfoxide isolated
from Allium cepa Linn.

Kumari K, Mathew BC, Augusti KT.

Department of Biochemistry, University of Kerala, Trivandrum.

S/​methyl cysteine sulphoxide (SMCS), a sulphur containing amino acid isolated
from onion (Allium cepa Linn) showed antidiabetic and antihyperlipidemic
effects. Oral administration of SMCS daily at a dose of 200 mg/kg body weight
for a period of 45 days to alloxan diabetic rats controlled significantly their
blood glucose and lipids in serum and tissues and altered the activities of
liver hexokinase, glucose 6/​phosphatase and HMG CoA reductase towards normal.
The above effects of SMCS were comparable to those of glibenclamide and insulin.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 7665195 [PubMed /​ indexed for MEDLINE]

383: Plant Physiol. 1994 Dec;106(4):1623/​1631.

Fourier/​Transform Raman and Fourier/​Transform Infrared Spectroscopy (An
Investigation of Five Higher Plant Cell Walls and Their Components).

Sene C, McCann MC, Wilson RH, Grinter R.

School of Chemical Sciences, University of East Anglia, Norwich Research Park,
Norwich, NR4 7TJ, United Kingdom (C.F.B.S., R.G.).

Infrared and Raman spectra of sequentially extracted primary cell walls and
their pectic polymers were obtained from five angiosperm plants.
Fourier/​transform Raman spectrometry was shown to be a powerful tool for the
investigation of primary cell/​wall architecture at a molecular level, providing
complementary information to that obtained by Fourier/​transform infrared
microspectroscopy. The use of an extraction procedure using imidazole instead of
cyclohexane trans/​1,2/​N,N,N[prime],N[prime]/​diaminotetraacetate allows the
extension of the infrared spectral window for data interpretation from 1300 to
800 cm/​1, to 2000 to 800 cm/​1, and allows us to obtain Raman spectra from
extracted cell/​wall material. Wall constituents such as pectins, proteins,
aromatic phenolics, cellulose, and hemicellulose have characteristic spectral
features that can be used to identify and/or fingerprint these polymers without,
in most cases, the need for any physical separation. The Gramineae (rice [Oryza
sativa], polypogon [Polypogon fugax steud], and sweet corn [Zea mays]) are
spectroscopically very different from the nongraminaceous monocotyledon (onion
[Allium cepa]) and the dicotyledon (carrot [Daucus carota]); this reflects
differences in chemical composition and cross/​linking of the walls. The
possibility of a taxonomic classification of plant cell walls based on infrared
and Raman spectroscopies and the use of spectral fingerprinting for
authentication and detection of adulteration of products rich in cell/​wall
materials are discussed.

PMID: 12232436 [PubMed /​ as supplied by publisher]

384: Mutat Res. 1994 Oct 16;310(2):175/​85.

The present status of higher plant bioassays for the detection of environmental
mutagens.

Grant WF.

Department of Plant Science, McGill University, Que., Canada.

Higher plants provide valuable genetic assay systems for screening and
monitoring environmental pollutants. They are now recognized as excellent
indicators of cytogenetic and mutagenic effects of environmental chemicals and
are applicable for the detection of environmental mutagens both indoor and
outdoor. Comparisons between plant and nonplant genetic assay systems indicate
that higher plant genetic assays have a high sensitivity (i.e. few false
negatives). Two assays which are considered ideal for in situ monitoring and
testing of airborne and aqueous mutagenic agents are the Tradescantia stamen
hair assay for mutations and the Tradescantia micronucleus assay for chromosome
aberrations. Both assays can be used for in vivo and in vitro testing. Other
higher plant genotoxicity assays which have a large number of genetic markers
and/or data base and are also highly suitable for testing for genotoxic agents
include Arabidopsis thaliana, Allium cepa, Hordeum vulgare, Vicia faba, and Zea
mays. Since higher plant systems are now recognized as excellent indicators of
the cytotoxic, cytogenetic, and mutagenic effects of environmental chemicals and
have unique advantages for in situ monitoring and screening it is recommended
that higher plant systems be accepted by regulatory authorities as an
alternative first/​tier assay system for the detection of possible genetic damage
resulting from pollution or the use of environmental chemicals. The results from
higher plant genetic assays could make a significant contribution in protecting
the public from agents that can cause mutation and cancer. The advantages
possessed by higher plant genetic assays, which are inexpensive and easy to
handle, make them ideal for use by scientists in developing countries.

Publication Types:
Research Support, Non/​U.S. Gov't
Review

PMID: 7523890 [PubMed /​ indexed for MEDLINE]

385: Chromosoma. 1994 Oct;103(6):432/​40.

Reorganization and condensation of chromatin in mitotic prophase nuclei of
Allium cepa.

Hao S, Jiao M, Zhao J, Xing M, Huang B.

Institute of Genetics and Cytology, Northeast Normal University, Changchun,
Jilin, People's Republic of China.

This paper studies the process and features of chromosome construction in
mitotic prophase cells of Allium cepa. The results showed that a prominent
reorganization of chromatin occurred during G2/​/​early prophase. The 250/​400 nm
thick compact chromatin threads in G2 nuclei began to disorganize into about 30,
100 and 220 nm chromatin fibres which constituted the loosely organized
chromosome outlines in early prophase before chromosome condensation. In middle
prophase, chromosome condensation was characterized by the formation of many
condensed regions (aggregates of chromatin), which increased in size (1/​1.5
microns) when prophase proceeded. Meanwhile, the chromatin threads that
constituted and connected the condensed regions became increasingly thicker
(120/​250 nm). In late prophase adjacent condensed regions fused to form
cylinder/​shaped chromosomes. Based on these observations, we come to the
conclusion that the construction of prophase chromosomes is a two/​step process,
that is, the reorganization and condensation of chromatin. In addition, we
report the study of silver/​stained, DNA/​ and histone/​depleted prophase
chromosomes, describe morphological features of the non/​histone protein (NHP)
residue in early, middle and late prophase chromosomes, and discuss the roles of
NHPs in chromosome construction.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 7859564 [PubMed /​ indexed for MEDLINE]

386: Plant Physiol. 1994 Sep;106(1):87/​96.

Purification and Characterization of Two Distinct NAD(P)H Dehydrogenases from
Onion (Allium cepa L.) Root Plasma Membrane.

Serrano A, Cordoba F, Gonzalez/​Reyes JA, Navas P, Villalba JM.

Departamento de Biologia Celular, Facultad de Ciencias, Universidad de Cordoba,
Avda. San Alberto Magno s/n, E/​14004/​Cordoba, Spain.

Highly purified plasma membrane fractions were obtained from onion (Allium cepa
L.) roots and used as a source for purification of redox proteins. Plasma
membranes solubilized with Triton X/​100 contained two distinct polypeptides
showing NAD(P)H/​dependent dehydrogenase activities. Dehydrogenase I was purified
by gel filtration in Sephacryl S/​300 HR, ion/​exchange chromatography in
DEAE/​Sepharose CL/​6B, and dye/​ligand affinity chromatography in Blue/​Sepharose
CL/​6B after biospecific elution with NADH. Dehydrogenase I consisted of a single
polypeptide of about 27 kD and an isoelectric point of about 6. Dehydrogenase II
was purified from the DEAE/​unbound fraction by chromatography in Blue/​Sepharose
CL/​6B and affinity elution with NADH. Dehydrogenase II consisted of a single
polypeptide of about 31 kD and an isoelectric point of about 8. Purified
dehydrogenase I oxidized both NADPH and NADH, although higher rates of electron
transfer were obtained with NADPH. Maximal activity was achieved with NADPH as
donor and juglone or coenzyme Q as acceptor. Dehydrogenase II was specific for
NADH and exhibited maximal activity with ferricyanide. Optimal pH for both
dehydrogenases was about 6. Dehydrogenase I was moderately inhibited by
dicumarol, thenoyltrifluoroacetone, and the thiol reagent N/​ethyl/​maleimide. A
strong inhibition of dehydrogenase II was obtained with dicumarol,
thenoyltrifluoroacetone, and the thiol reagent p/​hydroxymercuribenzoate.

PMID: 12232306 [PubMed /​ as supplied by publisher]

387: Plant Cell Physiol. 1994 Sep;35(6):963/​7.

The oligosaccharide units of the xyloglucans in the cell walls of bulbs of
onion, garlic and their hybrid.

Ohsumi C, Hayashi T.

Basic Research Laboratories, Ajinomoto Co. Inc., Kawasaki, Japan.

Xyloglucans were isolated from the 24% KOH/​soluble fraction of the cell walls of
bulbs of onion (Allium cepa), garlic (Allium sativum) and their hybrid. The
polysaccharides yielded single peaks upon gel filtration with average molecular
weights of 65,000 for onion, 55,000 for garlic and 82,000 for the hybrid.
Compositional analysis of the oligosaccharide units after digestion with an
endo/​1,4/​beta/​glucanase from Streptomyces indicated that the polysaccharides
were constructed of four kinds of repeating oligosaccharide unit, namely, a
decasaccharide (glucose/xylose/galactose/fucose, 4 : 3: 2 : 1), a nonasaccharide
(glucose/xylose/galactose/fucose, 4 : 3 : 1 : 1), an octasaccharide
(glucose/xylose/galactose, 4 : 3 : 1), and a heptasaccharide (glucose/xylose, 4
: 3). The xyloglucan from the hybrid contained highly fucosylated units that
resembled those from onion rather than from garlic. The analysis also revealed
that the xyloglucans from Allium species contain highly substituted xylosyl
residues with fucosyl/​galactosyl residues, suggesting that these
monocotyledonous plants resemble dicotyledons in the structural features of
their xyloglucans.

PMID: 7981966 [PubMed /​ indexed for MEDLINE]

388: Jpn J Genet. 1994 Aug;69(4):407/​15.

Allodiploid nature of Allium wakegi Araki revealed by genomic in situ
hybridization and localization of 5S and 18S rDNAs.

Hizume M.

Biological Institute, Faculty of Education, Ehime University, Matsuyama, Japan.

Allium wakegi Araki could be originated from cross hybridization between close
relatives of a form of A. cepa and A. fistulosum. Chromosomes of each parental
haploid set were identified in the chromosome complement of A. wakegi by genomic
in situ hybridization using probes of the total, parental genomic DNAs of A.
cepa and A. fistulosum, respectively. The results of GISH suggested significant
differentiation of genomic DNAs between these closely related species. Allium
cepa had two 5S rDNA loci at the interstitial regions of the short arms of small
chromosome pair (the 7th pair) and A. fistulosum had one locus at the
interstitial region of the homologous short arms. Allium wakegi had two
chromosomes carrying one and two 5S rDNA loci which appeared to correspond to
those of A. fistulosum and A. cepa, respectively. Chromosomes carrying 18S rDNA
loci originated from those of both A. cepa and A. fistulosum were also observed
in the chromosome complement of A. wakegi.

PMID: 7946461 [PubMed /​ indexed for MEDLINE]

389: Plant Physiol. 1994 Jul;105(3):999/​1006.

A Cationic Channel in the Guard Cell Tonoplast of Allium cepa.

Amodeo G, Escobar A, Zeiger E.

Department of Biology (G.A., E.Z.), and Department of Physiology (A.E.),
University of California, Los Angeles, California 90024.

Stomatal movements depend on an osmoregulation process in which swelling or
shrinking of the guard cells opens or closes the stomatal pore. Ions and water
fluxes are an essential aspect of guard cell osmoregulation. Thus far, studies
of these fluxes have focused on the guard cell plasma membrane. Guard cells,
however, are a multi/​compartment system that includes a prominent vacuole, which
has a primary role in turgor regulation. This study reports on a detailed
characterization of an ion channel at the guard cell tonoplast of Allium cepa
(onion). We used patch/​clamp methodology with isolated tonoplast patches to
study conduction and gating at the single channel level. A voltage/​dependent
outward/​rectifying cationic channel (210 picosiemens) was the dominant
conductance. In symmetrical solutions the channel displayed an ohmic behavior in
its current/​voltage relationship. It also showed a very large rectification in
the open probability. The channel was predominantly cationic and its sequence of
ionic selectivity was weak (Na+ > K+ > Rb+ > Cs+). The channel conductance was
not affected by intravacuolar pH. Analysis of membrane patches with multiple
channels showed that the probability of a channel to open was independent of the
opening of the other channels present in the patch and that there was a
conservation of the open probability for different channels. Ensemble records
generated using a pulse protocol showed slow activation and deactivation
kinetics. A first/​latency analysis of single/​channel records in response to
protocols with different prepulse duration indicated that this channel has more
than one closed state.

PMID: 12232260 [PubMed /​ as supplied by publisher]

390: Biosci Biotechnol Biochem. 1994 Jul;58(7):1324/​5.

Malonylated anthocyanins from bulbs of red onion, Allium cepa L.

Terahara N, Yamaguchi M, Honda T.

Department of Food Science and Technology, College of Horticulture,
Minami/​Kyushu University, Miyazaki, Japan.

Four cyanidin/​based anthocyanins (1/​4) were isolated from the red onion, Allium
cepa L. Pigments 1 and 3 were identified as cyanidin 3/​glucoside (Cy 3/​Glc) and
3/​malonylglucoside (Cy 3/​MaGlc), respectively, by cochromatography with standard
pigments. Anthocyanins 2 and 4 were respectively determined as cyanidin
3/​laminaribioside (Cy 3/​Lam) and 3/​malonyllaminaribioside (Cy 3/​MaLam), a new
anthocyanin, mainly by NMR techniques. Malonylated anthocyanins 3 and 4 were
found for the first time in red onions.

PMID: 7765255 [PubMed /​ indexed for MEDLINE]

391: Environ Pollut. 1994;86(1):1/​4.

Effects of lead on root growth, cell division, and nucleolus of Allium cepa.

Liu D, Jiang W, Wang W, Zhao F, Lu C.

Department of Biology, Tianjin Normal University, Tianjin 300074, People's
Republic of China.

The effects of different concentrations of lead nitrate on root growth, cell
division, chromosome morphology and nucleolus in root tip cells of Allium cepa
were studied. The concentrations of lead nitrate (Pb(NO(3))(2)) were 10(/​7),
10(/​6), 10(/​5), 10(/​4), 10(/​3) and 10(/​2) m. It was observed that lead reduces
root growth and causes mitotic irregularities, including c/​mitosis, anaphase
bridges, and chromosome stickiness. Also, interphase cells with micronuclei,
irregularly shaped nuclei and nuclei with decomposed nuclear material were
noticed. The c/​mitotic effect reached its maximum in the meristem at above
10(/​4) m Pb, when practically almost all the anomalous dividing cells are of
this type. After treatment with Pb, there were many similar silver/​stained
particulate materials scattered in the nucleus in short, rounded meristem cells
and in long, oblong root cap cells.

PMID: 15091642 [PubMed]

392: Plant Physiol. 1994 Jan;104(1):281/​284.

Loss of Microtubules in the Interphase Cells of Onion (Allium cepa L.) Root Tips
from the Cell Cortex and Their Appearance in the Cytoplasm after Treatment with
Cycloheximide.

Mineyuki Y, Iida H, Anraku Y.

Department of Biological Science, Faculty of Science, Hiroshima University,
Kagamiyama 1/​3/​1, Higashi/​Hiroshima 724, Japan (Y.M.).

As part of a project to investigate the mechanism of cortical microtubule (MT)
alignment, we examined the effects of cycloheximide (CHM) on cortical MTs in the
root tip cells of Allium cepa L. Results show that although a preprophase band
of MTs remained in the cell cortex, interphase MTs disappeared from the cortical
cytoplasm and then appeared concomitantly in the inner cytoplasm when the rate
of de novo protein synthesis was reduced with CHM (11/​360 [mu]M for 2 h)

PMID: 12232080 [PubMed /​ as supplied by publisher]

393: Plant Physiol. 1994 Jan;104(1):271/​276.

Nutrient Uptake Changes in Ascorbate Free Radical/​Stimulated Onion Roots.

Gonzalez/​Reyes JA, Hidalgo A, Caler JA, Palos R, Navas P.

Departamento de Biologia Celular, Universidad de Cordoba, 14004 Cordoba, Spain.

Long/​term treatments with ascorbate free radical/​stimulated glucose, fucose,
sucrose, and nitrate uptake in Allium cepa roots. Glucose and fucose showed
saturation kinetics in untreated roots, but after treatment with the ascorbate
free radical, uptake was linear with time. Although the rates of nitrate and
sucrose uptake increased after treatment with ascorbate free radical, the
kinetics were similar to those observed in the controls. Ascorbate and
dehydroascorbate inhibited nutrient uptake. The uptake rates for all nutrients
increased throughout the 48/​h period of pretreatment with ascorbate free
radical. During the treatment an increase in the vacuole volume and tonoplast
surface area also occurred. These results show the relationship between an
increase in vacuolar volume and stimulated nutrient uptake from ascorbate/​free
radical, resulting in enhanced root elongation. These results suggest that
activation of a transplasma membrane redox system by ascorbate/​free radical is
involved in these responses.

PMID: 12232078 [PubMed /​ as supplied by publisher]

394: Mech Ageing Dev. 1994 Jan;73(1):1/​7.

Changes in nuclear macromolecules and nucleolar volume associated with selective
ribosomal cistron activation by ethylene.

Bhattacharya PK, Karagiannis CS, Pappelis AJ.

Department of Biology, Indiana University Northwest, Gary 46408.

Pieces of leaf base tissue from the equatorial region of the third turgid onion
(Allium cepa L.; yellow, sweet Spanish, quiescent tissue) leaf base with two
visible major nucleoli (volume = 0.51 microns3) and two inactive minor nucleolar
organizer regions (NORs) in the outer epidermal cells were placed in shallow
water (time = T0 control). After 3 h (T3 control), the two visible nucleoli
enlarged (178% of T0) and changed shape (from 88% round and 12% oval at T0 to 5%
round, 68% oval, 20% elongated/​oval, and 7% dumbbell). The minor NORs remained
inactive. Nuclear RNA and non/​histone protein (nHP) increased (RNA = 128% and
nHP = 134%, compared with T0 data, set at 100%). The content of DNA and histone
protein (H) in nuclei remained unchanged. Major nucleoli in pieces of onion
placed in 10(/​5) M ethylene enlarged and minor nucleoli became visible in 33% of
the nuclei; i.e., ethylene acted as a selective ribosomal cistron regulator. The
nucleolar volume (212% of T0) was statistically greater than those for T0 and
T3. DNA and H remained unchanged (not statistically different) but RNA (159% of
T0) and nHP (169% of T0) were greater (statistically significant) than those for
T0 and T3 controls. Cobalt chloride (10(/​5) M Co) alone or in 10(/​5) M ethylene
(Co + E) inhibited the enlargement of some of the major nucleoli and completely
inhibited the appearance of minor nucleoli. The nucleolar volumes for the cobalt
and for cobalt/​ethylene treatments were significantly less than those for T3
controls and ethylene treatment at T3. DNA and histone did not change.(ABSTRACT
TRUNCATED AT 250 WORDS)

PMID: 8028393 [PubMed /​ indexed for MEDLINE]

395: Mech Ageing Dev. 1993 Dec 31;72(3):199/​211.

Ethylene is a selective ribosomal cistron regulator in Allium cepa epidermal
cells.

Karagiannis CS, Pappelis AJ.

Department of Plant Biology, Southern Illinois University at Carbondale 62901.

In Allium cepa L. (onion) the number, size, and morphology of visible nucleoli
per nucleus varies during cell division, growth, differentiation, storage,
activation of quiescent tissue, senescence, wounding, and disease (host/​pathogen
interactions). Since there are two types (differentiated visually by size) of
ribosomal cistrons in onion (major and minor nucleoli differ in the external
spacer nucleotide sequences), we inferred that they function separately. In
controls, major nucleolar organizer regions (NORs) were visible in epidermal
cell nuclei as nucleoli. After exposure of the tissue to ambient conditions,
these nucleoli enlarged and changed morphology. Minor NORs (when in the genome)
required more than 6 h to become developed as visible nucleoli. In the ethylene
treatments, the major NORs (visible nucleoli in quiescent epidermal cells)
increased in size a (activation of a greater number of tandem rRNA genes) as in
the controls. The minor, quiescent NORs became active and visible (activation of
quiescent, inactive NORs) within 3 h. Actinomycin D, and cycloheximide, with or
without ethylene, inhibited the increase in size of the major NORs, and
prevented activation of the minor NORs (i.e. they did not become visible).
Silver nitrate and cobalt chloride had no effect on major NORs but inhibited the
appearance of minor nucleoli when combined with ethylene treatments. We infer:
ethylene acts to regulate the expression of the minor NORs (selective ribosomal
cistron regulation); and, other hormone(s) are involved in the regulation of the
major NORs. Yellow and white sweet Spanish onions we studied had two major NORs
and two minor NORs. Red sweet Spanish onions we studied had only the two major
NORs.

PMID: 8196424 [PubMed /​ indexed for MEDLINE]

396: J Cell Sci. 1993 Dec;106 ( Pt 4):1333/​46.

Ultrastructural rRNA localization in plant cell nucleoli. RNA/RNA in situ
hybridization, autoradiography and cytochemistry.

Olmedilla A, Testillano PS, Vicente O, Delseny M, Risueno MC.

Centro de Investigaciones Biologicas, Madrid, Spain.

The distribution of ribosomal transcripts in the plant nucleolus has been
studied by non/​isotopic in situ hybridization in ultrathin Lowicryl K4M sections
and by high/​resolution autoradiography after labelling with tritiated uridine.
In parallel, cytochemical techniques were applied to localize RNA on different
plant nucleolar components of Allium cepa L. root meristematic cells and
Capsicum annuum L. pollen grains. For RNA/RNA in situ hybridization, several
biotinylated single/​stranded ribosomal RNA probes were used for mapping
different fragments of the 18 S and the 25 S rRNA gene transcribed regions.
Ribosomal RNAs (from pre/​rRNAs to mature 18 and 25 S RNAs) were found in the
nucleolus, in the dense fibrillar (DFC) and granular components (GC).
Hybridization signal was found at the periphery of some fibrillar centres (FCs)
with probes recognizing both 18 and 25 S rRNA sequences. A quantitative study
was performed to analyze the significance of this labelling. Incorporation of
tritiated uridine into roots was carried out and, later, after a long
time/​exposure, autoradiography revealed the presence of newly synthesized RNA
mainly in the DFC and at the periphery of the FCs. The presence of RNA in these
areas was also confirmed by the cytochemical techniques used in this study.
Taken together, these data favour the hypothesis that transcription can begin at
the periphery of the FCs, although we cannot exclude the possibility that the
DFC plays a role in this process.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 8126112 [PubMed /​ indexed for MEDLINE]

397: Plant Mol Biol. 1993 Oct;23(2):365/​76.

Cloning and characterization of the lectin cDNA clones from onion, shallot and
leek.

Van Damme EJ, Smeets K, Engelborghs I, Aelbers H, Balzarini J, Pusztai A, van
Leuven F, Goldstein IJ, Peumans WJ.

Laboratory for Phytopathology and Plant Protection, Katholieke Universiteit
Leuven, Belgium.

Characterization of the lectins from onion (Allium cepa), shallot (A.
ascalonicum) and leek (A. porrum) has shown that these lectins differ from
previously isolated Alliaceae lectins not only in their molecular structure but
also in their ability to inhibit retrovirus infection of target cells. cDNA
libraries constructed from poly(A)/​rich RNA isolated from young shoots of onion,
shallot and leek were screened for lectin cDNA clones using colony
hybridization. Sequence analysis of the lectin cDNA clones from these three
species revealed a high degree of sequence similarity both at the nucleotide and
at the amino acid level. Apparently the onion, shallot and leek lectins are
translated from mRNAs of ca. 800 nucleotides. The primary translation products
are preproproteins (ca. 19 kDa) which are converted into the mature lectin
polypeptides (12.5/​13 kDa) after post/​translational modifications. Southern blot
analysis of genomic DNA has shown that the lectins are most probably encoded by
a family of closely related genes which is in good agreement with the sequence
heterogeneity found between different lectin cDNA clones of one species.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, P.H.S.

PMID: 8106012 [PubMed /​ indexed for MEDLINE]

398: Mutat Res. 1993 Oct;319(2):89/​101.

The mutagenicity of Gramoxone (paraquat) on different eukaryotic systems.

el/​Abidin Salam AZ, Hussein EH, el/​Itriby HA, Anwar WA, Mansour SA.

Department of Genetics, Faculty of Agriculture, Ain Shams University, Cairo,
Egypt.

The possible mutagenicity of the herbicide Gramoxone was evaluated using five
different living systems: Allium cepa, Vicia faba, yeast, Drosophila
melanogaster and human lymphocytes. The results indicate that Gramoxone has
mutagenic activity at the cytological level in Allium cepa, Vicia faba and human
lymphocytes. All doses were effective in inducing chromosomal abnormalities and
a clear dose/​response relationship was observed in the various cytological
tests. Analysis of chromosomal abnormalities revealed that this herbicide
displays clastogenic and turbagenic activities. At the gene mutation level
Gramoxone induced gene conversion at the trp/​5 locus and reversion at the ilv
locus in Saccharomyces cerevisiae. In Drosophila melanogaster, Gramoxone proved
to be mutagenic to germ cells and induced a high frequency of sex/​linked
recessive lethals (SLRL). At the protein level, Gramoxone had detectable
mutagenic effects on the genetic background of two enzymes, Adh and Est/​6.
Gramoxone should be considered a mutagenic herbicide.

PMID: 7692291 [PubMed /​ indexed for MEDLINE]

399: J Cell Sci. 1993 Sep;106 ( Pt 1):431/​9.

Immunological characterization of lamins in the nuclear matrix of onion cells.

Minguez A, Moreno Diaz de la Espina S.

Laboratorio de Biologia Celular y Molecular Vegetal, Centro de Investigaciones
Biologicas, Madrid, Spain.

We have used polyclonal and monoclonal antibodies against different lamins from
vertebrates, and the IFA antibody recognizing all kinds of intermediate filament
proteins, to investigate the lamins of the nuclear matrix of Allium cepa
meristematic root cells. All the antibodies react in the onion nuclear matrix
with bands in the range of 60/​65 kDa, which are enriched in the nuclear matrix
after urea extraction, and do not crossreact with other antibodies recognizing
intermediate filaments in plants (AFB, anti/​vimentin and MAC 322), ruling out
crossreaction with contaminating intermediate filaments of cytoplasmic bundles.
In 2/​D blots the chicken anti/​lamin serum reacts with one spot at 65 kDa and pI
6.8 and the anti B/​type lamin antibodies with another one at 64 kDa and pI 5.75.
Both crossreact with IFA. The lamin is localized at the nuclear periphery and
the lamina by indirect immunofluorescence. Immunogold labelling of nuclear
matrix sections reveals that the protein is not only associated with the lamina,
but also with the internal matrix. Taken together these results reveal that
higher plants, which do not possess an organized network of cytoplasmic
intermediate filaments, nevertheless present a well/​organized lamina containing
lamins in which at least one of them is immunologically related to vertebrate
lamin B. Our data confirm that lamins are very old members of the intermediate
filament proteins that have been better conserved in plants during evolution
than their cytoplasmic counterparts.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 8270641 [PubMed /​ indexed for MEDLINE]

400: Plant Physiol. 1993 Apr;101(4):1305/​1315.

Water Transport in Onion (Allium cepa L.) Roots (Changes of Axial and Radial
Hydraulic Conductivities during Root Development).

Melchior W, Steudle E.

Lehrstuhl fur Pflanzenokologie, Universitat Bayreuth, Postfach 101251, D/​8580
Bayreuth, Germany.

The hydraulic architecture of developing onion (Allium cepa L. cv Calypso) roots
grown hydroponically was determined by measuring axial and radial hydraulic
conductivities (equal to inverse of specific hydraulic resistances). In the
roots, Casparian bands and suberin lamellae develop in the endodermis and
exodermis (equal to hypodermis). Using the root pressure probe, changes of
hydraulic conductivities along the developing roots were analyzed with high
resolution. Axial hydraulic conductivity (Lx) was also calculated from stained
cross/​sections according to Poiseuille's law. Near the base and the tip of the
roots, measured and calculated Lx values were similar. However, at distances
between 200 and 300 mm from the apex, measured values of Lx were smaller by more
than 1 order of magnitude than those calculated, probably because of remaining
cross walls between xylem vessel members. During development of root xylem, Lx
increased by 3 orders of magnitude. In the apical 30 mm (tip region), axial
resistance limited water transport, whereas in basal parts radial resistances
(low radial hydraulic conductivity, Lpr) controlled the uptake. Because of the
high axial hydraulic resistance in the tip region, this zone appeared to be
"hydraulically isolated" from the rest of the root. Changes of the Lpr of the
roots were determined by measuring the hydraulic conductance of roots of
different length and referring these data to unit surface area. At distances
between 30 and 150 mm from the root tip, Lpr was fairly constant (1.4 x 10/​7 m
s/​1 MPa/​1). In more basal root zones, Lpr was considerably smaller and varied
between roots. The low contribution of basal zones to the overall water uptake
indicated an influence of the exodermal Casparian bands and/or suberin lamellae
in the endodermis or exodermis, which develop at distances larger than 50 to 60
mm from the root tip.

PMID: 12231786 [PubMed /​ as supplied by publisher]

401: Biotech Histochem. 1993 Mar;68(2):83/​6.

Giemsa G/​banding in Allium.

Peffley EB, de Vries JN.

Department of Agronotomy, Horticulture, and Entomology, Texas Tech University,
Lubbock 79409.

Using divergent Giemsa staining protocols designed for other plant species,
G/​banding was visualized in the chromosomes of Allium cepa L., A. fistulosum L.,
and their interspecific (A. fistulosum x A. cepa) hybrid. This is the first
demonstration of G/​banding of Allium chromosomes. Differences and similarities
with other Giemsa banding patterns in Allium are discussed.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 8494955 [PubMed /​ indexed for MEDLINE]

402: Plant Physiol. 1993 Feb;101(2):589/​594.

Inhibition of Sucrose:Sucrose Fructosyl Transferase by Cations and Ionic
Strength.

Chevalier PM, Rupp RA.

Department of Crop and Soil Sciences, Washington State University, Pullman,
Washington 99164/​6420.

Fructans are storage carbohydrates found in many temperate grasses. The first
enzyme in the biosynthetic pathway of most fructans is sucrose:sucrose fructosyl
transferase (SST). In this report, we demonstrate that K+ and ionic strength
noncompetitively inhibit the activity of SST from wheat (Triticum aestivum L.)
stems. The Ki for this inhibition is high, 122 mM, but in the range of
concentrations of K+ found in the tissue (205/​314 mM). Addition of KCl to the
assay system had no effect on the pH optimum (5.5) or the Km for sucrose (266
mM) but reduced the Vmax. At equivalent ionic strengths, inhibition by choline
chloride was about half that of KCl, indicating that inhibition by ionic
strength might be responsible for approximately 50% of the KCl inhibition.
Inhibition by LiCl and (NH4)2SO4 was similar to that by choline chloride.
Soluble invertase activity found in the SST preparations was less sensitive to
KCl and more sensitive to choline chloride than was SST. SST from barley
(Hordeum vulgare L.) stems and leaves, as well as SST from leaves of
orchardgrass (Dactylis glomerata), was also inhibited by KCl. SST from onion
(Allium cepa L.) bulbs and asparagus (Asparagus officinalis L.) stems was not
inhibited by KCl; thus, inhibition of activity by KCl is not a universal
characteristic of SST from all sources.

PMID: 12231714 [PubMed /​ as supplied by publisher]

403: Bull Environ Contam Toxicol. 1993 Feb;50(2):199/​204.

Cytotoxic effects of distillary waste on Allium cepa L.

Mishra K.

Department of Botany, Lucknow University, India.

PMID: 8422522 [PubMed /​ indexed for MEDLINE]

404: Plant Physiol. 1993 Feb;101(2):353/​61.

Nuclear targeting of the maize R protein requires two nuclear localization
sequences.

Shieh MW, Wessler SR, Raikhel NV.

Michigan State University, Department of Energy Plant Research Laboratory, East
Lansing 48823/​1312.

Previous genetic and structural evidence indicates that the maize R gene encodes
a nuclear transcriptional activating factor. In/​frame carboxyl/​ and
amino/​terminal fusions of the R gene to the reporter gene encoding
beta/​glucuronidase (GUS) were sufficient to direct GUS to the nucleus of the
transiently transformed onion (Allium cepa) epidermal cells. Further analysis of
chimeric constructs containing regions of the R gene fused to the GUS cDNA
revealed three specific nuclear localization sequences (NLSs) that were capable
of redirecting the GUS protein to the nucleus. Amino/​terminal NLS/​A (amino acids
100/​109, GDRRAAPARP) contained several arginine residues; a similar localization
signal is found in only a few viral proteins. The medial NLS/​M (amino acids
419/​428, MSERKRREKL) is a simian virus 40 large T antigen/​type NLS, and the
carboxyl/​terminal NLS/​C (amino acids 598/​610, MISESLRKAIGKR) is a mating type
alpha 2 type. NLSs M and C are independently sufficient to direct the GUS
protein to the nucleus when it is fused at the amino terminus of GUS, whereas
NLS/​A fused to GUS partitioned between the nucleus and cytoplasm. Similar
partitioning was observed when localization signals NLS/​A and NLS/​C were
independently fused to the carboxy/​terminal portion of GUS. A sequential
deletion of the localization signals indicated that the amino/​terminal and
carboxyl/​terminal fusions of R and GUS were redirected to the nucleus only when
both NLS/​A and /​M, or NLS/​C and /​M, were present. These results indicate that
multiple localization signals are necessary for nuclear targeting of this
protein. The conservation of the localization signals within the alleles of R
and similar proteins from other organisms is also discussed.

Publication Types:
Comparative Study
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 8278504 [PubMed /​ indexed for MEDLINE]

405: J Toxicol Environ Health. 1993 Jan;38(1):89/​101.

Acute and subacute toxicity tests of onion coat, natural colorant extracted from
onion (Allium cepa L.), in (C57BL/6 x C3H)F1 mice.

Kojima T, Tanaka T, Mori H, Kato Y, Nakamura M.

1st Department of Pathology, Gifu University School of Medicine, Gifu City,
Japan.

The toxicity test of onion coat colorant (OC), a food colorant extracted from
onion (Allium cepa L.), was undertaken using (C57BL/6 x C3H)F1 mice of both
sexes for the safety assessment of this product. The acute toxicity test was
performed by administration of OC suspended in corn oil by gavage at doses of
2500, 5000, 7500, and 10,000 mg/kg body weight to groups of 5 or 6 males and 6
or 7 females, maintained for 14 d. Six of 12 females dosed at 10,000 mg/kg body
weight and 3 of 11 females dosed at 7500 mg/kg body weight were dead before the
end of the study, indicating that the tolerated dose of OC was between 7500 and
5000 mg/kg body weight. The subacute toxicity test of OC was examined using 123
mice of both sexes (62 males and 61 females) by feeding a diet mixed with OC at
concentrations of 5, 2.5, 1.25, 0.6, and 0.3% for 90 d. All mice tolerated these
doses of OC well. The body weight gains of male and female mice were not
affected by the treatment. Histopathological examinations showed that
hyperplastic changes in the esophagus, forestomach, pancreas, cervix, and
endometrium of mice were found in treated and control mice. However, their
incidences were not related to the dose of OC. Moreover, only a spontaneous
ovarian teratoma was found in an OC/​treated mouse. These results suggest that OC
has no acute and subacute toxic effects in mice.

PMID: 8421325 [PubMed /​ indexed for MEDLINE]

406: Tsitol Genet. 1993 Jan/​Feb;27(1):13/​8.

[A comparative ecological/​genetic assessment of the mutagenic background in 2
agricultural districts of the Transcarpathian Province]

[Article in Russian]

Kurinnyi AI, Zubko ES, Kravchuk AP.

The estimation of the total mutagenic overloading and chromosome variability in
population of two Transcarpathian regions in Ukraine differing in the intensity
of pesticides use has been studied. The statistically significant differences in
mutagenicity of soil (on the growing seed Allium cepa), mutability of
agricultural crops (Vicia sativa, Avena sativa) and chromosome aberrations level
in peripheral lymphocytes in juveniles have been determined.

Publication Types:
Comparative Study
English Abstract

PMID: 8316952 [PubMed /​ indexed for MEDLINE]

407: Planta. 1993;191(3):357/​61.

Gamma/​tubulin is associated with a cortical/​microtubule/​organizing zone in the
developing guard cells of Allium cepa L.

McDonald AR, Liu B, Joshi HC, Palevitz BA.

Department of Botany, University of Georgia, Athens 30602.

A key event in the differentiation of elliptically shaped guard cells such as
those in Allium is the formation of a radial array of cortical microtubules
(Mts) which, by controlling the orientation of wall microfibrils, plays an
important role in cell shaping. Previous experiments strongly indicated that the
array is nucleated in a zone adjacent to the new ventral wall soon after
cytokinesis. In order to further clarify the function of this zone, we performed
dual immunolocalizations on Allium guard cells with anti/​beta/​tubulin, to detect
Mts, and an antibody to gamma/​tubulin, a protein known to be present at
Mt/​organizing centers in other species and recently identified in plants as
well. gamma/​Tubulin antibody stained the cortical zone adjacent to the ventral
wall, while little or no fluorescence was present elsewhere along the radial Mt
array or at other sites in the cell. The antibody also stained the mitotic poles
and phragmoplast in guard mother cells, as it does in other material. No
staining was seen when the primary antibody was omitted. The results are
consistent with nucleation of the radial array at a cortical/​Mt/​organizing zone
next to the ventral wall, and set the stage for more in/​depth studies on the
spatial and temporal control of Mt formation in differentiating cells.

Publication Types:
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.
Research Support, U.S. Gov't, P.H.S.

PMID: 7764024 [PubMed /​ indexed for MEDLINE]

408: Plant Physiol. 1992 Dec;100(4):1940/​1947.

Fourier Transform Infrared Microspectroscopy Is a New Way to Look at Plant Cell
Walls.

McCann MC, Hammouri M, Wilson R, Belton P, Roberts K.

Department of Cell Biology, John Innes Centre for Plant Science Research,
Norwich Research Park, Colney Lane, Norwich, NR4 7UH, United Kingdom.

Highly reproducible Fourier transform infrared (FTIR) spectra from both single
onion (Allium cepa) cell walls and their constituent polymers were obtained
under a variety of sampling conditions. The specificity of the chemical
extraction sequence used in the preparation of the material was confirmed:
pectins only are extracted by cyclohexanediaminetetraacetic acid and sodium
carbonate, whereas xyloglucans are extracted by increasing concentrations of
potassium hydroxide. There was very little contamination of the first potassium
hydroxide extract with residual pectin. The low abundance of both phenolics and
protein was also confirmed. The first sodium carbonate extraction almost
completely removes esters remaining in the cell wall. We have demonstrated that
FTIR spectroscopy can detect large conformational changes in pectic polymers on
removal from the cell wall and on drying. FTIR spectroscopy provides a powerful
and rapid assay for wall components and putative cross/​links by identifying
polymers and functional groups nondestructively in muro. The availability of
micro/​sampling and data acquisition techniques that permit subtraction of the
blanket absorption of water make FTIR spectroscopy particularly suitable for
studies of cell wall architecture. The use of polarizers with the microscope
accessory permits determination of the orientation of particular functional
groups with respect to the direction of cell elongation in carrot suspension
cells.

PMID: 16653221 [PubMed /​ as supplied by publisher]

409: Eur J Biochem. 1992 Oct 15;209(2):751/​7.

Isolation and characterization of alliinase cDNA clones from garlic (Allium
sativum L.) and related species.

Van Damme EJ, Smeets K, Torrekens S, Van Leuven F, Peumans WJ.

Laboratory for Phytopathology and Plant Protection, Katholieke Universiteit
Leuven, Belgium.

cDNA libraries constructed from poly(A)/​rich RNA isolated from Allium sativum
(garlic), Allium cepa (onion) and Allium ascalonicum (shallot) were screened for
cDNA clones encoding the alliinase using colony hybridization. Sequence analysis
of the alliinase cDNA clones from different Alliaceae species revealed a high
degree of sequence similarity both at the nucleotide and at the amino acid
level. Apparently, the alliinases are translated from mRNA species of
approximately 2200 nucleotides. The primary translation products are
preproproteins which are converted into the mature alliinases following
post/​translational modifications. In the case of the garlic alliinase, the mRNA
encodes a 486/​amino/​acid polypeptide with a molecular mass of 55,623 Da.
Cleavage of the signal peptide (28 amino acids) results in a preprotein which
extends 10 amino acids before the first amino acid of the mature protein of
51,451 Da. Southern/​blot analysis of genomic DNA has shown that the alliinases
are most probably encoded by a family of closely related genes, which is in good
agreement with the sequence heterogeneity found between different alliinase cDNA
clones of one species.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 1385120 [PubMed /​ indexed for MEDLINE]

410: Eur J Cell Biol. 1992 Jun;58(1):163/​71.

A limited number of chromosomes makes a nucleus competent to respond to inducers
of replication and mitosis in a plant.

Gimenez/​Martin G, Panzera F, Canovas JL, de la Torre C, Lopez/​Saez JF.

Centro de Investigaciones Biologicas, CSIC, Madrid, Spain.

Multinucleate tetraploid cells with unbalanced chromosomal distribution in
aneuploid nuclei were obtained in Allium cepa L. root meristems. For this, their
natural diploid cells were treated with a multipolarizing agent (1 h
carbetamide) followed by an inhibitor of cytokinesis (1 h caffeine). Data from
these multinucleate cells with aneuploid nuclei suggest that only four out of
the thirty/​two chromosomes of their autotetraploid complement possess DNA
sequences making the nucleus competent to respond to inducers of replication and
mitosis. Direct observation of cells where a single replicated chromosome had
reached mitosis showed that this chromosome was the one bearing the nucleolar
organizer. Six specific chromosomes would confer competence to the nucleus to
respond to inducers of replication but not to those producing chromosome
condensation. Another four different chromosomes would confer the nucleus with
the ability to respond to mitotic inducers but not to replication inducers. The
rest of the chromosomal complement seemed to lack any of the DNA sequences
needed for these two important cycle transitions. In a nutshell, certain DNA
sequences distributed in a few chromosomes of the onion complement are an
intranuclear requirement to initiate replication and mitosis in these plant
cells.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 1644061 [PubMed /​ indexed for MEDLINE]

411: Radiat Res. 1992 Jun;130(3):275/​80.

Variation of RBE between p(75) + Be and d(50) + Be neutrons determined for
chromosome aberrations in Allium cepa.

Beauduin M, Laublin G, Octave/​Prignot M, Gueulette J, Wambersie A.

Universite Catholique de Louvain, Cliniques Universitaires St/​Luc, Brussels,
Belgium.

The RBE of p(75) + Be neutrons relative to d(50) + Be neutrons has been
determined for chromosome aberrations induced in Allium cepa (onion) roots. Two
biological criteria were selected: the average number of aberrations (mainly
fragments) per cell in anaphase and telophase, and the percentage of
aberration/​free cells. The influence of sampling time (3 to 7 h incubation)
between irradiation and fixation was investigated systematically. This factor
did not significantly influence the results. The RBE values of p(75) + Be
neutrons compared to those of d(50) + Be neutrons were 0.85 (0.79/​0.91) and 0.87
(0.80/​0.95) for the first and the second criteria, respectively. In previous
experiments for the same beams, we found an RBE of 0.90 (0.86/​0.94) for survival
of V79 cells (D0 ratio), 0.96 (0.93/​0.99) for the intestinal crypt cell system,
and 0.83 (0.70/​0.96) for Vicia faba growth delay.

Publication Types:
Comparative Study

PMID: 1317594 [PubMed /​ indexed for MEDLINE]

412: J Am Vet Med Assoc. 1992 Apr 15;200(8):1090/​4.

Hematologic effects and feeding performance in cattle fed cull domestic onions
(Allium cepa).

Lincoln SD, Howell ME, Combs JJ, Hinman DD.

Caine Veterinary Teaching and Research Center, University of Idaho, Caldwell, ID
83605.

For 119 days, 36 cattle, allotted to 6 treatment groups, were fed a balanced
growth diet containing 0, 5, 10, 15, 20, or 25% cull onions on a dry/​matter
basis. Cattle performance was comparable to that associated with barley/​base
non/​onion diet; statistical differences were not observed among treatments.
During the first 28 days of the study, reduction in numbers of RBC, hemoglobin
concentration, and PCV was observed in all cattle fed onions, but clinical
anemia was not seen in any individual animal. After onion feeding was
discontinued at 119 days, RBC numbers, hemoglobin concentration, and PCV
returned to baseline values within 30 days. Heinz bodies were detected in
erythrocytes of all cattle fed onions, and the percentage was proportional to
the amount of onions consumed. Addictive onion consumption was prevented by
mixing chopped or crushed onions in a total balanced ration.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 1607313 [PubMed /​ indexed for MEDLINE]

413: Mutat Res. 1992 Apr;266(2):215/​9.

A comparative study of the potentiating effect of caffeine and poly/​D/​lysine on
chromosome damage induced by X/​rays in plant cells.

Mateos S, Panneerselvam N, Mateos JC, Cortes F.

Department of Cell Biology, Faculty of Biology, Sevilla, Spain.

X/​Ray/​induced chromosomal aberrations (CA) were potentiated by post/​treatments
in G2 with either caffeine (caff) or poly/​D/​lysine (PDL) in root/​tip cells of
Allium cepa. The enhancement of the yield of CA was concomitant with an increase
in the frequency of mitosis. Our results seem to support the idea of a direct
relationship between radiation/​induced G2 delay and repair of chromosome damage.
Here we report on similarities between caffeine and PDL in both decreasing G2
delay and enhancing chromatid aberration yield. The possible molecular
mechanism(s) of action responsible for the cytogenetic effects observed are
discussed.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 1373831 [PubMed /​ indexed for MEDLINE]

414: Mutat Res. 1992 Feb;281(2):89/​92.

The effect of lead on Allium cepa L.

Lerda D.

Hospital Regional Dr. Abel Ayerza, Marcos Juarez, Argentina.

The effect of lead on Allium cepa L. at concentrations of 0.1, 1.0, 10, 50, 100
and 200 ppm were studied. Analysis focused on root growth, frequency of mitosis
in a meristematic zone, and chromosomal aberrations. It was observed that lead
reduces root growth and the frequency of mitotic cells in meristematic zones,
and increases the frequency of aberrant cells. The intensity of the effects is a
function of lead concentration.

PMID: 1370986 [PubMed /​ indexed for MEDLINE]

415: Biol Cell. 1992;74(3):243/​7.

Early and late replicating DNA involved in the G1 to S transition in Allium cepa
L meristematic cells.

Gonzalez/​Fernandez A, Aller P, Sans J, De la Torre C.

Centro de Investigaciones Biologicas, CSIC, Madrid, Spain.

The involvement of portions of the genome replicated at different times of the S
period in the regulation of the G1 to S transition was analyzed in Allium cepa L
meristem cells. For this, DNA bromosubstitution confined to discrete portions of
a previous S period followed by anoxic UVA irradiation (300/​400 nm light) was
performed in synchronous cells. Sequences replicated in late S appeared to be
involved in the positive regulation of the initiation of replication. Hence,
cells were prevented from initiating replication if irradiated at mid G1 only
when the DNA sequences replicated in the last third of the previous S period
were bromosubstituted. Cycloheximide/​induced inhibition of protein synthesis at
late G1 also prevented the G1 to S transition. Sequences replicated in mid S
appeared unrelated to any control of the initiation of replication. On the other
hand, sequences replicated in the first third of the S period seemed to be
involved in the negative regulation of the initiation of replication, since
irradiation after previous bromosubstitution of early replicating DNA sequences
advanced G1 cells into the next S phase and increased the proliferative fraction
of the population. Finally, the simultaneous inactivation of DNA sequences
involved in both positive and negative regulation of replication allowed the
cells to enter into S.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 1628107 [PubMed /​ indexed for MEDLINE]

416: Int J Food Microbiol. 1991 Nov;14(2):171/​4.

Dietary exposure to aflatoxin in Benin City, Nigeria: a possible public health
concern.

Ibeh IN, Uraih N, Ogonor JI.

Department of Microbiology, Faculty of Science, University of Benin, Nigeria.

A total of 100 samples of various foods comprising of 10 samples each of garri
(Manihot utilis Pohl), beans (Phaseolus lunatus), yam flour (Dioscorea
rotundata), cassava flour (Manihot esculentum), melon (Citrulus lunatus), onion
(Allium cepa), rice (Oryza sativa), plantain (Musa paradisiaca), red pepper
(Capsicum annuum L., Solanaceae) and eggs were screened for the presence of
aflatoxins. Fifty percent of yam flour; 40% of cassava flour; 30% of garri; 20%
of beans and melon and 10% of rice yielded aflatoxin. The implications of this
incidence of aflatoxin in common foodstuff found in this community is discussed.

PMID: 1777386 [PubMed /​ indexed for MEDLINE]

417: Mutat Res. 1991 Aug;263(4):203/​10.

Cycloheximide genotoxicity in in vitro and in vivo test systems.

Basic/​Zaninovic T, Papes D, Franekic J.

Faculty of Food Technology and Biotechnology, Zagreb, Yugoslavia.

The aim of this study was to investigate if there was any genotoxic effect
produced by the antibiotic cycloheximide, widely used as a fungicide in
agriculture as well as in everyday laboratory practice. The battery of test
systems included the bacterium Salmonella typhimurium (strains TA98 and TA100),
the yeast Saccharomyces cerevisiae (D7), Allium cepa somatic cells and mouse
bone marrow cells. This combination of test systems enabled us to establish
possible effects caused by cycloheximide at different levels of the genome and
to indicate a possible mechanism of action. The results obtained in experiments
showed that cycloheximide did not induce frameshift or base/​pair substitution
mutations in S. typhimurium regardless of metabolic activation. In S. cerevisiae
cycloheximide had only toxic effects but no increase of mitotic gene conversion
was noticed under the conditions of the experiment. However, in A. cepa somatic
cells as well as in mouse bone marrow cells cycloheximide showed its activity
causing different genetic damages, e.g., chromosome breaks, mitotic disturbances
and nuclear abnormalities.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 1861684 [PubMed /​ indexed for MEDLINE]

418: Bull Environ Contam Toxicol. 1991 Jul;47(1):104/​11.

Propachlor and N/​isopropylaniline residues in onions (Allium cepa) and muck
soils.

Clegg BS, Frank R, Ritcey GM, Souza/​Machado V, Benoit DL.

Ontario Provincial Pesticide Residue Testing Laboratory, Ontario Ministry of
Agriculture and Food, Guelph, Canada.

PMID: 1932849 [PubMed /​ indexed for MEDLINE]

419: J Postgrad Med. 1991 Jul;37(3):132/​5.

Beneficial effects of Allium sativum, Allium cepa and Commiphora mukul on
experimental hyperlipidemia and atherosclerosis/​/​a comparative evaluation.

Lata S, Saxena KK, Bhasin V, Saxena RS, Kumar A, Srivastava VK.

Department of Pharmacology, L. L. R. M. Medical College, Meerut, Uttar Pradesh.

Oral administration of petroleum ether extract of Allium sativum, Allium cepa
and ethylacetate extract of Commiphora mukul in albino rats significantly
prevented rise in serum cholesterol and serum triglyceride level, caused by
atherogenic diet. All the three agents were also found to confer significant
protection against atherogenic diet induced atherosclerosis.

Publication Types:
Comparative Study

PMID: 1784023 [PubMed /​ indexed for MEDLINE]

420: Plant Physiol. 1991 Mar;95(3):846/​852.

A Loss in the Plasma Membrane ATPase Activity and Its Recovery Coincides with
Incipient Freeze/​Thaw Injury and Postthaw Recovery in Onion Bulb Scale Tissue.

Arora R, Palta JP.

Department of Horticulture, University of Wisconsin, Madison, Wisconsin 53706.

Plasma membrane ATPase has been proposed to be functionally altered during early
stages of injury caused by a freeze/​thaw stress. Complete recovery from freezing
injury in onion cells during the postthaw period provided evidence in support of
this proposal. During recovery, a simultaneous decrease in ion leakage and
disappearance of water soaking (symptoms of freeze/​thaw injury) has been noted.
Since reabsorption of ions during recovery must be an active process, recovery
of plasma membrane ATPase (active transport system) functions has been
implicated. In the present study, onion (Allium cepa L. cv Downing Yellow Globe)
bulbs were subjected to a freeze/​thaw stress which resulted in a reversible
(recoverable) injury. Plasma membrane ATPase activity in the microsomes
(isolated from the bulb scales) and ion leakage rate (efflux/hour) from the same
scale tissue were measured immediately following thawing and after complete
recovery. In injured tissue (30/​40% water soaking), plasma membrane ATPase
activity was reduced by about 30% and this was paralleled by about 25% higher
ion leakage rate. As water soaking disappeared during recovery, the plasma
membrane ATPase activity and the ion leakage rate returned to about the same
level as the respective controls. Treatment of freeze/​thaw injured tissue with
vanadate, a specific inhibitor of plasma membrane ATPase, during postthaw
prevented the recovery process. These results indicate that recovery of
freeze/​injured tissue depends on the functional activity of plasma membrane
ATPase.

PMID: 16668063 [PubMed /​ as supplied by publisher]

421: Mutat Res. 1991 Mar;247(1):147/​51.

Premature onset of mitosis and potentiation of chromosome damage induced by
poly/​D/​lysine in plant cells: evidence for G2 repair.

Cortes F, Mateos S.

Departamento de Biologia Celular, Facultad de Biologia, Sevilla, Spain.

Poly/​D/​lysine has been reported to induce a triggering of mitosis in plant cells
due to a selective stimulatory effect on cells arrested in G2. Root/​tip cells of
Allium cepa L. were first exposed to maleic hydrazide (MH) early in the cell
cycle and posttreated with different concentrations of the polycationic agent
while in G2. The result was a dose/​dependent potentiation of chromosome damage
observed at metaphase without any apparent effect induced by poly/​D/​lysine
itself. The enhancement of the yield of chromosomal aberrations was concomitant
with an increase in the frequency of mitosis. In order to test further the
stimulatory effect of poly/​D/​lysine on mitosis, as well as the consequences of a
shortening of the time available for repair, cells synchronized by protracted
treatment with 5/​aminouracil (5/​AU), which also induces chromosome damage, were
allowed to recover in the presence of the polycationic compound. Our data show
that a premature arrival at mitosis resulted in an increase in the frequency of
damaged cells observed.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2002799 [PubMed /​ indexed for MEDLINE]

422: Mutat Res. 1991 Feb;259(2):127/​32.

Evaluation of mutagenic effect of the antihypertensive drug methyldopa (Aldomet)
on mammalian systems in vivo and in vitro and on Allium cepa.

Grisolia CK, Takahashi CS.

Faculdade de Medicina de Ribeirao Preto, Universidade de Sao Paulo, Brazil.

The antihypertensive drug methyldopa (Aldomet) was tested for possible
clastogenic activity on normal and hypertensive rats and on human lymphocyte
cultures and for its influence on the cell cycle of Allium cepa. The drug had no
clastogenic effect on rat bone marrow cells but showed a toxic effect on A. cepa
root tip cells and significantly increased the frequency of sister/​chromatid
exchanges in lymphocyte cultures, without any effect on the frequency of
chromosome aberrations.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 1994243 [PubMed /​ indexed for MEDLINE]

423: Environ Pollut. 1991;69(2/​3):169/​79.

Acceleration of catalase and peroxidase activities in Lemna minor L. and Allium
cepa L. in response to low levels of aquatic mercury.

Subhadra AV, Nanda AK, Behera PK, Panda BB.

Department of Botany, Berhampur University, Berhampur 760007, India.

The purpose of this study was to assess certain physiological responses of Lemna
minor L. (duckweed) and Allium cepa L. (onion) to aquatic mercury at low
concentrations. Following a 96/​h exposure of plants to nutrient medium
contaminated with known levels of mercuric chloride (HgCl(2)), 0.001 to 4 mg
litre(/​1) (0.0007 to 2.95 mg Hg litre(/​1)) or methyl mercuric chloride
(MeHgCl(2)), 0.0001 to 0.1 mg litre(/​1) (0.0007 to 0.07 mg Hg litre(/​1)), the
physiological endpoints measured were the growth of fronds (Lemna minor) or
roots (Allium cepa), and catalase and peroxidase activities in both plant
assays. The EC(50) for HgCl(2) on the basis of the growth curve of Lemna minor
was found to be 2.1 mg litre(/​1). HgCl(2) and MeHgCl(2) were lethal to L. minor
at concentrations of 4 and 0.01 mg litre(/​1), respectively. The range of low
concentrations that accelerated growth as well as enzymic activities in L. minor
was 0.004 to 0.04 mg litre(/​1) for HgCl(2) and 0.001 mg litre(/​1) for MeHgCl(2).
HgCl(2) and MeHgCl(2) induced maximum enzymic activity in Lemna fronds at
concentrations of 0.008 and 0.0005 mg litre(/​1), respectively. In Allium roots,
catalase activity was accelerated at all the concentrations of HgCl(2) (0.001/​2
mg litre(/​1)) and MeHgCl(2) (0.0001/​0.1 mg litre(/​1)) tested. The activity of
peroxidase was, however, accelerated by HgCl(2) at concentration range 0.01/​1.0
mg litre(/​1), or by MeHgCl(2) at 0.001 mg litre(/​1). The concentrations of
HgCl(2) and MeHgCl(2) that induced the highest enzymic activity in Allium roots
were 0.05 mg litre(/​1) and 0.001 mg litre(/​1), respectively.

PMID: 15092159 [PubMed]

424: Exp Cell Res. 1990 Dec;191(2):163/​70.

The probability of G1 cells to enter into S increases with their size while S
length decreases with cell enlargement in Allium cepa.

Canovas JL, Cuadrado A, Escalera M, Navarrete MH.

Centro de Investigaciones Biologicas, CSIC, Velazquez, Madrid, Spain.

The distribution of cell surface area projection (cell size) has been measured
at birth and at initiation of DNA synthesis in steady/​state populations of
Allium cepa root meristems. The conditional probability, P(I/G1), that
initiation occurs given that the event of being in G1 also occurs has been
estimated from these data. P(I/G1) was found to increase when cells became
larger. The distribution of G1 duration has been constructed from indicated cell
size distributions. The absolute frequencies of G1 times showed a maximum in the
zone of cells with short G1 periods; about 14% of cells appear to enter into S
with G1 congruent to 1 h. These results suggest that the increase of P(I/G1) was
due to cell enlargement and not to cell aging. By comparing the cell size
distribution at initiation of S and at the end of this period, a drastic
reduction of cell size variability during DNA replication was observed and both
curves were seen as rather similar in shape although they obviously had
different modal points. These observations support that there is a negative
correlation between the initiation size and the duration of genome duplication,
and that cells which initiate DNA synthesis with the same size have a similar
replication time. From this hypothesis, a plot of S duration versus cell size at
initiation of this period was constructed by comparing the distributions of cell
size at start and end of replication; this plot was also consistent with the
existence of a negative correlation between cell initiation size and S length.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2257874 [PubMed /​ indexed for MEDLINE]

425: J Histochem Cytochem. 1990 Dec;38(12):1879/​87.

Ag/​NOR proteins and rDNA transcriptional activity in plant cells.

Moreno FJ, Rodrigo RM, Garcia/​Herdugo G.

Department of Cell Biology, Faculty of Biology, University of Seville, Spain.

In this work we used Allium cepa root meristem cells in actively growing
conditions and under treatment with the protein synthesis inhibitors
cycloheximide (CHM) and puromycin. Morphological and quantitative results
indicate that these drugs induce dramatic alterations in nucleolar structure
reflected by a decrease of nucleolar size, much more evident under treatment
with CHM, and by segregation of its main components. Quantitative analysis shows
a decrease in NOR/​silver staining after treatment with CHM, whereas in cells
treated with puromycin NOR/​silver staining remains constant. Our results reveal
a decrease in the Ag/​NOR proteins under conditions of diminished cell activity,
suggesting a direct relationship between the quantity of Ag/​NOR proteins and
transcriptional activity. Using two/​dimensional gel electrophoresis and
NOR/​silver staining in gels, we have characterized some proteins corresponding
to molecular weights of 28 and 31 KD and pI of approximately 5.2. After
treatment with CHM, reactivity of these proteins against NOR/​silver staining is
diminished. By means of a morphological study, analysis of NOR/​silver staining,
and of anti/​DNA and RNAse/​gold labeling, we have tried an approach to the
nucleolar organization in plant cells. Our results suggest that the fibrillar
component shows a reticular distribution where fibrillar centers, as described
in animal cells, are not distinguished.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 1701461 [PubMed /​ indexed for MEDLINE]

426: Bull Environ Contam Toxicol. 1990 Nov;45(5):767/​74.

Cytological abnormalities induced by mercury water pollutants on Allium cepa L.

Pal R, Nandi S.

Department of Botany, Burdwan University, West Bengal, India.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2265277 [PubMed /​ indexed for MEDLINE]

427: Mutat Res. 1990 Oct;242(2):157/​61.

Comparison of different plants in screening for Mn clastogenicity.

Mukhopadhyay MJ, Sharma A.

Department of Botany, University of Calcutta, India.

Cationic (MnSO4.H2O) and anionic (KMnO4) manganese salts in aqueous solutions
enhanced the frequency of chromosomal aberrations including both chromosome/​ and
chromatid/​type breaks, gaps, translocations and spindle disturbances in
different plant systems in vivo to a statistically significant level. The
activity of the cationic salt was more drastic, particularly on the submerged
plant studied (Vallisneria spiralis L.), on prolonged exposure, when compared
with bulbs of Allium cepa L. and seeds of Pisum sativum L.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2233832 [PubMed /​ indexed for MEDLINE]

428: Int J Radiat Biol. 1990 Mar;57(3):537/​41.

Evidence for an adaptive response to radiation damage in plant cells conditioned
with X/​rays or incorporated tritium.

Cortes F, Dominguez I, Mateos S, Pinero J, Mateos JC.

Departamento de Biologia Celular, Facultad de Biologia, Sevilla, Spain.

Allium cepa root/​tip cells were first exposed to low 'conditioning' doses of
ionizing radiation: to X/​rays (0.06 or 0.26 Gy) or to incorporated tritium (1.8
x 10(4) or 7.2 x 10(4) Bq/ml; specific activity: 740.0 GBq/mmol) and
subsequently given a 'challenge' dose of 1.5 Gy of X/​rays. A reduction in
X/​ray/​induced chromosomal damage was brought about by prior exposure to 0.26 Gy
of X/​rays, while cells receiving the lower conditioning dose (0.06 Gy of X/​rays)
did not show any significant reduction. In cells grown in the presence of
[3H]TdR on the other hand, the adaptive response was evident after both doses
given. The results are essentially in agreement with those published by Wolff's
group for human lymphocytes in showing that plant cells in vivo can become
'adapted' by exposure to low/​level irradiation so that they become more
resistant to the clastogenic effects of X/​rays delivered subsequently.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 1968946 [PubMed /​ indexed for MEDLINE]

429: Environ Pollut. 1990;66(4):289/​99.

Yield loss assessments for cultivars of broccoli, lettuce, and onion exposed to
ozone.

Temple PJ, Jones TE, Lennox RW.

Statewide Air Pollution Research Center, University of California, Riverside, CA
92521, USA.

The effects of the photochemical oxidant air pollutant ozone (O(3)) on growth
and yield of three garden crops, broccoli (Brassica oleracea L.), lettuce
(Lactuca sativa L.), and onion (Allium cepa L.) were studied in an open/​top
chamber experiment conducted in the field in southern California. Four cultivars
each of leaf lettuce, broccoli, and globe onion were exposed to
charcoal/​filtered air (CF), non/​filtered (NF) air, or NF plus 1.5 times ambient
O(3) concentration from 4 weeks after germination in January or February until
harvest. Exposures lasted 31 days for lettuce, 55 to 78 days for broccoli, and
105 days for onion. Results showed that despite severe O(3) injury to outer
leaves, lettuce yields were not affected by O(3). Broccoli also was resistant to
O(3) and no growth reduction was observed at ambient O(3) concentrations. Onions
were more susceptible to O(3), but only one cv. 'Rio Bravo' had significant
yield losses (ca. 5%) at ambient O(3) levels. These results suggest that, in
general, concentrations of O(3) in the winter and spring may be below the
threshold for adverse effects on yields of broccoli, lettuce and onion.

PMID: 15092228 [PubMed]

430: Exp Cell Res. 1990 Jan;186(1):90/​8.

Cell cycle/​ and differentiation stage/​dependent variation of dUTPase activity in
higher plant cells.

Pardo EG, Gutierrez C.

Centro de Investigaciones Biologicas, Madrid, Spain.

Deoxyuridine triphosphate nucleotidohydrolase (dUTPase), a key enzyme in
pyrimidine nucleotide metabolism, specifically hydrolyzes deoxyuridine
triphosphate (dUTP) to deoxyuridine monophosphate and inorganic pyrophosphate.
This enzyme activity has been studied in cellular extracts from Allium cepa root
meristem cells with two specific aims: (i) to determine how the properties of
the plant enzyme compare with those of dUTPase purified from other sources, and
(ii) to analyze the relationship between dUTPase activity and cell proliferation
and cell differentiation. Plant dUTPase is highly specific for dUTP, with an
apparent Km of 6 microM, is highly sensitive to EDTA and it is probably a
metalloenzyme. Our results demonstrate the presence of high levels of dUTPase in
both resting and proliferating root meristem cells. The enzyme activity appears
to be tightly regulated during the cell cycle. dUTPase activity increases at the
G1/S boundary, remains high throughout S phase, and shows almost undetectable
levels during G1 and G2. We have also found that dUTPase activity in
differentiated cells, located in the mature portion of the root, is barely
detectable. Altogether our results indicate that dUTPase activity is modulated
by the proliferation rate and that this activity progressively decreases as
cells initiate their differentiation program.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2153555 [PubMed /​ indexed for MEDLINE]

431: Cytobios. 1990;61(246/​247):187/​93.

Differences in the effectiveness of EDTA to induce SCEs and chromosomal
aberrations in CHO and Allium cepa chromosomes.

Ortiz T, Cortes F.

Departamento de Biologia Celular, Facultad de Biologia, Universidad de Sevilla,
Spain.

The chelating agent EDTA was able to produce chromosome aberrations (CA) in CHO
cells when it was administered simultaneously with BrdUrd (2 x 10(/​5) M),
without any concomitant effect on the yield of sister chromatid exchanges
(SCEs). Root meristematic cells of Allium cepa did not show any type of CA when
they were treated with different doses of EDTA (with or without BrdUrd 10(/​4) M)
while the SCE frequency was increased in a dose/​dependent fashion. These effects
of EDTA have not been previously reported. It is suggested that deprivation of
divalent cations (Ca(+)+/Mg(+)+) probably play an important role in DNA
replication and repair processes.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2114256 [PubMed /​ indexed for MEDLINE]

432: Gen Pharmacol. 1990;21(3):273/​6.

Comparative study of the in vitro synthesis of prostaglandins and thromboxanes
in plants belonging to Liliaceae family.

Ali M, Afzal M, Hassan RA, Farid A, Burka JF.

Department of Biochemistry, Faculty of Science, Kuwait University, Safat.

1. Homogenates of garlic (Allium sativum), onions (Allium cepa) and Allium porum
were in vitro incubated with [14C]arachidonic acid. 2. Separation of labelled
prostaglandins and thromboxanes were accomplished by thin/​layer chromatography
(TLC) and the Rf values were compared with those of authentic standards. 3. The
prostaglandins identified were 6/​keto/​PGF1 alpha, PGF2 alpha, TXB2, PGE2 and
PGD2. 4. PGE2 and PGD2 were the major metabolites of arachidonic acid among all
the members of the Liliaceae family studied. 5. Garlic was found to have the
highest capacity to metabolize the [14C]arachidonic acid into prostaglandins and
thromboxanes. 6. The synthesis of prostaglandins and thromboxanes, was inhibited
by preincubation of homogenates with indomethacin or was completely destroyed by
boiling the plant extract prior to incubation with arachidonic acid. This
confirmed the presence of cyclooxygenase in these plants.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 2111258 [PubMed /​ indexed for MEDLINE]

433: Folia Histochem Cytobiol. 1990;28(1/​2):79/​95.

Analysis of the cell cycle in the root meristem of Allium cepa under the
influence of ledakrin.

Antosiewicz D.

Institute of Botany, Faculty of Biology, University of Warsaw, Poland.

The influence of a polish anticancer drug on the cell cycle using Allium test
was studied. Methods of aceto/​orcein squash slides, curve of labelled mitoses
after 3H/​thymidine incubation and cytophotometrics after Feulgen's reaction were
employed. Ledakrin acts strongly antimitotically, but it does not block the cell
cycle completely. The cytostatic activity of ledakrin results from its action on
the interphase. The phases G1 and S are prolonged while M is unchanged after 6h
incubation with ledakrin. During postincubation in water without ledakrin it was
noted, at the beginning, that the mitotic activity decreases and it is brought
about the lengthening of S and G2 phases. The duration of the cell cycle phases
returns to the control level during further postincubation. The results of
analysis of chromatin aberrations and the micronucleus test point to a mutagenic
effect of ledakrin.

PMID: 2097185 [PubMed /​ indexed for MEDLINE]

434: Exp Cell Res. 1989 Nov;185(1):277/​82.

Cell size of proliferating plant cells increases with temperature: implications
in the control of cell division.

Cuadrado A, Navarrete MH, Canovas JL.

Centro de Investigaciones Biologicas, Madrid, Spain.

As chemical reactions related to the regulation of cell proliferation are
governed by availability, amount, and concentration of relevant molecules, it
has been suggested that cell size is an important factor in the control of cell
cycle. We have measured the size of proliferating cells of Allium cepa roots in
which growth rate was modified by changes in growth temperature. Two independent
cell size parameters have been measured by cytophotometry: cell surface area
projection and cell protein content. Average cell sizes of both the
proliferating cell population and the subpopulation at the end of mitosis show
that cell size increases with growth rate. Calculation of cell size at
initiation of DNA replication clearly indicates that average cell size at this
point is not growth invariant but positively correlated with growth rate.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2806410 [PubMed /​ indexed for MEDLINE]

435: Mutat Res. 1989 Aug;226(4):235/​8.

Testing of genotoxic effects of 2,4/​dichlorophenoxyacetic acid (2,4/​D) using
multiple genetic assay systems of plants.

Kumari TS, Vaidyanath K.

Department of Genetics, Osmania University, Hyderabad, India.

The mutagenic activity of 2,4/​D was assessed utilising cytogenetic, chlorophyll
mutation, specific/​locus and pollen viability endpoints in Allium cepa and Oryza
sativa. In the Allium root/​tip assay onion bulbs with roots were treated with
25, 50, 75 or 100 ppm 2,4/​D for 4 h and the frequency of aberrations was
estimated. With an increase in concentration there was rise in frequency of
aberrant cells. In the case of mutation assays, presoaked rice seeds were
treated with 100, 200 or 300 ppm 2,4/​D for 4 h and sown in the field. Mutation
frequency was estimated on M1 plant, spike and M2 seedling basis. With
increasing concentration, there was a concomitant increase in mutation
frequency. Highly significant chlorophyll/​deficient and waxy mutants besides
sterile pollen were observed as compared to both positive (EMS) and negative
controls (H2O). The study demonstrates that 2,4/​D has genotoxic potential.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2761564 [PubMed /​ indexed for MEDLINE]

436: Mutat Res. 1989 Aug;216(4):203/​9.

Erratum in:
Mutat Res 1989 Dec;216(6):387.

A standardized method for the three/​way differential staining of plant
chromosomes and the scoring of SCEs per cell cycle.

Escalza P, Pinero J, Cortes F.

Departamento de Biologia Celular, Facultad de Biologia, Sevilla, Spain.

We have made use of 2 alternative methodologies to obtain 3/​way differential
staining (TWD) in third/​mitosis (M3) chromosomes of Allium cepa, which involve
different uptakes of bromodeoxyuridine (BrdU) through 3 cell divisions, in order
to evaluate the sister/​chromatid exchanges (SCE) frequency on a per/​cell/​cycle
basis. The main innovation introduced by us to the original protocols previously
reported has been the use of 5/​fluorodeoxyuridine (FdU) to inhibit endogenous
thymidine (dT) synthesis. By using different [BrdU]:[dT] ratios in the presence
of FdU the relative incorporation of BrdU into replicating DNA can be
controlled. The use of 2 different approaches to obtain 3/​way differentiation of
sister chromatids allowed us to evaluate the role of BrdU in the induction of
SCEs in our system. Both procedures rendered nearly 100% of M3 chromosomes
showing TWD. An additional advantage of our methodologies is their high degree
of reproducibility.

PMID: 2474763 [PubMed /​ indexed for MEDLINE]

437: Mutat Res. 1989 Jul;223(3):313/​9.

Effects of certain food dyes on chromosomes of Allium cepa.

Roychoudhury A, Giri AK.

Department of Botany, University of Calcutta, India.

The effects of 4 permitted food dyes, i.e., fast green FCF, indigo carmine,
orange G and tartrazine, and the non/​permitted dye metanil yellow on chromosomes
of Allium cepa are reported. A significant increase in polyploid cells was
observed in all cases. High doses of these dyes induced chromosome breaks and
micronucleus formation. Although all dyes produced mitotic aberrations, metanil
yellow and fast green FCF showed comparatively stronger clastogenic activity.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2739686 [PubMed /​ indexed for MEDLINE]

438: Cell Tissue Kinet. 1989 Jul;22(4):319/​31.

The maintenance of colchicine/​arrested metaphases in plants requires protein
synthesis.

Sans J, Utrilla L, De la Torre C.

Departamento de Biologia Celular y Genetica, Facultad de Medicina, Universidad
de Chille.

With the aim of finding out factors involved in chromosomal condensation, the
kinetics of both metaphase accumulation and the subsequent formation of
restitution nuclei in the presence of 1 mM colchicine have been analyzed in
Allium cepa L. meristems. Restitution nuclei are formed by decondensation of the
chromosomes from the c/​mitoses and the reformation of nuclear envelopes around
them. The study has been carried out in control conditions as well as in
conditions which either inhibit protein synthesis (1 microgram/ml cycloheximide)
or modify the accuracy of transcription (by near ultraviolet light irradiation
under anoxia of cells with bromosubstituted/​DNA). The results suggest that the
high condensation of chromosomes observed in colchicine/​arrested metaphases
depends on sustained synthesis of protein, and that the DNA regions coding for
such proteins are transcribed not before late prophase. By using cells, the
genome of which has been partially bromosubstituted, fed bromodeoxyuridine
during different fractions of this S period, it could be inferred that the
coding regions for the proteins involved in chromosome condensation are probably
multiple since they replicate throughout the whole S period.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2605619 [PubMed /​ indexed for MEDLINE]

439: Mutat Res. 1989 Jun;226(2):115/​20.

G2 effects of DNA/​repair inhibitors on chromatid/​type aberrations in root/​tip
cells treated with maleic hydrazide and mitomycin C.

Mateos S, Pinero J, Ortiz T, Cortes F.

Departamento de Biologia Celular, Facultad de Biologia, Sevilla, Spain.

In recent years the existence of a DNA/​repair process in G2 has been proposed to
explain the potentiating effects of DNA/​repair inhibitors given in G2 on
chromatid aberrations (CA) induced by S/​dependent as well as S/​independent
DNA/​damaging agents. In the present report, root/​tip cells of Allium cepa were
exposed to maleic hydrazide (MH) or mitomycin C (MMC) and post/​treated in G2
with caffeine (Caff) and various inhibitors of DNA synthesis. No enhancement of
chromosome damage was observed when Caff was present in G2, but hydroxyurea (HU)
or 5/​fluorodeoxyuridine (FdUrd) potentiated the frequencies of CA. A slight
additional increase of CA frequencies was observed following treatment with Ara
C and excess thymidine in G2. When MH/​damaged cells were pulse/​treated with Caff
earlier during recovery, the yield of CA was enhanced. The earlier Caff was
present following MH treatment, the stronger was the potentiation.

Publication Types:
In Vitro
Research Support, Non/​U.S. Gov't

PMID: 2525228 [PubMed /​ indexed for MEDLINE]

440: J Nutr Sci Vitaminol (Tokyo). 1989 Apr;35(2):155/​61.

Effect of oral ingestion of different fractions of Allium cepa on the blood and
erythrocyte membrane lipids and certain membrane/​bound enzymes in rats.

Ahluwalia P, Mohindroo A.

Department of Biochemistry, Panjab University, Chandigarh, India.

The effect of oral ingestion of different fractions of onion (Allium
cepa)/​/​extract, residue, and whole/​/​at a dose level equivalent to intake of 50 g
of onion per day for a 70/​kg man, for 30 days, to male adult, normal, albino
rats was studied on blood and erythrocyte membrane lipids and certain
membrane/​bound enzymes. Onion extract and residue showed hypercholesterolemic
effect, while whole onion showed hypocholesterolemic effect in blood. In
erythrocyte membranes, all the fractions had hypocholesterolemic and
hypolipidemic effect, which was accompanied by changes in the erythrocyte
membrane enzymes studied, i.e., alkaline and acid phosphatase, 5'/​nucleotidase,
total and Mg2+ ATPase. The above study indicated that it is safer to take whole
onion rather than onion residue or extract, because whole onion could lower the
blood cholesterol level even in normal condition and has a less pronounced
effect on the micro/​environment of the cells.

PMID: 2525181 [PubMed /​ indexed for MEDLINE]

441: Cell Biol Int Rep. 1989 Mar;13(3):283/​9.

Exponential pattern of cell age distribution in dividing cells of plant
meristems.

Cuadrado A, Navarrete MH, Canovas JL.

Centro de Investigaciones Biologieas, C.S.I.C., Madrid, Spain.

In order to determine the pattern of cell age distribution in proliferating
cells of Allium cepa roots we have measured by cytophotometry two cell size
parameters, protein content and surface area projection, in cells that
correspond to the entire proliferating population or only to the ana/​telophase
subpopulation. The size values of ana/​telophase cells have been employed to
construct theoretical size distributions for the entire proliferating cell
population of the root meristem by assuming either a uniform or an exponential
cell age distribution. Statistical comparison of theoretical distributions with
the experimental one rules out a uniform cell age distribution and strongly
favours an exponential age distribution similar to that found in bacteria.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2706689 [PubMed /​ indexed for MEDLINE]

442: Mutagenesis. 1989 Mar;4(2):157/​9.

Uptake and DNA photodamage induced in plant cells in vivo by two cationic
porphyrins.

Villanueva A, Canete M, Hazen MJ.

Departamento de Biolgia, Facultad de Ciencias, Universidad Autonoma de Madrid,
Spain.

The in vivo uptake of two cationic porphyrins: mesotetra (4/​N/​methylpyridyl)
porphine (T4MPyP) and its zinc complex (ZnT4MPyP) was determined in Allium cepa
meristematic cells. Both photosensitizers (10(/​7) M for 4 h) penetrated into the
nucleus producing a red fluorescence of chromatin under blue/​violet (436 nm)
exciting light. The ability of T4MPyP and ZnT4MPyP to induce DNA photodamage was
measured by the sister chromatid exchange (SCE) test.
5/​Bromo/​2'/​deoxyuridine/​substituted chromosomes treated with both the porphyrins
(10(/​8)M for 4 h) showed increased frequencies of SCE when they were
postirradiated with 436 nm light. A higher genotoxic effect was observed for
ZnT4MPyP than the other compound.

PMID: 2659928 [PubMed /​ indexed for MEDLINE]

443: Environ Pollut. 1989;58(4):313/​23.

Carbaryl/​A selective genotoxicant.

Grover IS, Ladhar SS, Randhawa SK.

School of Life Sciences, Guru Nanak Dev University, Amritsar/​143005, India.

Mutagenic effects of carbaryl, a contact insecticide with slight systemic
properties, have been investigated employing histidine reversion assay in
Salmonella typhimurium strains and in vivo chromosomal aberrations in root
meristems of Allium cepa. A detailed investigation revealed that carbaryl did
not enhance significantly the frequency of histidine revertants in any of the
strains of Salmonella i.e. frameshift mutagen tester (TA98), base pair
substitution tester strain (TA1535) and ochre mutant strain (TA102). The
supplementation with S9 mix did not have any appreciable effect. S14 prepared
from wheat seedlings also did not enhance the reversion frequency significantly.
However, carbaryl induced both clastogenic and physiological types of
chromosomal aberration. The spectrum of chromosomal aberrations included
c/​mitosis, stickiness, vagrant chromosomes, polyploidy multi/​polarity, delayed
anaphases, end to end joining of chromosomes, chromosome breaks, ring
chromosomes and anaphase bridges. The frequency of chromosomal aberrations was
reduced by transferring the carbaryl treated bulbs to distilled water for 24 and
48 h. Similarly, recovery in the mitotic index was noticed by such transfer. The
differences between the two assays may be attributed to differences in the
metabolism of the test organisms.

PMID: 15092421 [PubMed]

444: Acta Pol Pharm. 1989;46(1):34/​8.

[Evaluation of the cytostatic activity of 4/​(R/​alpha/​
phenylaminobenzylidene)morpholine iodides by the Triticum and Allium tests]

[Article in Polish]

Andrzejczuk A, Santus M.

Cytostatic activity of seven derivatives of
4/​(alpha/​phenylaminobenzylidene)morpholinium iodide was examined by the
phytobiological methods with Triticum and Allium cepa roots. The obtained
results were compared with the effects of isonicotinic hydrazide (INH).

Publication Types:
English Abstract
In Vitro

PMID: 2816462 [PubMed /​ indexed for MEDLINE]

445: Cytobios. 1989;58(233):71/​8.

Allium test for air and water borne pollution control.

al/​Sabti K.

Jozef Stefan Institute, University of Ljubljana, Yugoslavia.

An Allium cepa test was used to study the genotoxicity of the ecosystem.
Elevated frequencies of chromosomal aberrations (CA) and root growth inhibition
were observed in Allium as a result of exposure to genotoxicants investigated in
rainfall, snowfall, a petrochemical polluted site and in aquarium water,
compared with the relevant control. The Allium test has been shown to be a
useful tool for the detection of potentially genotoxic substances in air and
water screening programmes.

Publication Types:
Comparative Study

PMID: 2805813 [PubMed /​ indexed for MEDLINE]

446: Folia Histochem Cytobiol. 1989;27(2):107/​12.

The lack of correlation between the rate of rRNA transport from nucleoli into
cytoplasm and the duration of G1 and G2 phases in root meristem cells.

Olszewska MJ, Bilecka A, Kuran H, Marciniak K, Osiecka R.

Department of Plant Cytology and Cytochemistry, University of Lodz, Poland.

In root meristems of 3 species (Secale cereale L., Vicia faba L. subsp. minor,
Allium cepa L.) the durations of cell cycles and their phases were calculated
using 3H/​thymidine labelling. In the above species and in Helianthus annuus L.
(parameters of the cell cycle determined earlier) the G1 and G2 phase durations
were different: G1 + 1/2 M from 3 h to 6.1 h, G2 + 1/2 M from 1.1. h to 8.3 h,
depending on the species. The rate of rRNA transport from nucleoli into
cytoplasm during recovery after cold treatment was calculated from our data
presented earlier. The results indicate that in 4 species studied there is no
correlation (at P = 0.05) between the rate of rRNA transport and the duration of
G1 and G2 phases.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2767280 [PubMed /​ indexed for MEDLINE]

447: J Basic Microbiol. 1989;29(3):131/​9.

Cytological effects of fungal metabolites produced by fungi isolated from
Egyptian poultry feedstuffs.

Abdou RF, Megalla SE, Moharram AM, Abdel/​Gawad KM, Sherif TH, el/​Syed Mahmood
AL, Lottfy AE.

Department of Genetics, Assiut University, Egypt.

The cytogenetic effects of fungal metabolites produced by 113 strains belonging
to 36 fungal species and isolated form 5 substrates of commercial poultry
feedstuffs were tested for their effect on the growing root meristems of Allium
cepa. The fungal metabolites of Paecilomyces canescens, Aspergillus fumigatus,
Syncephalastrum racemosum, Aspergillus terreus and Mucor hiemalis strongly
suppressed cell division. Metabolites from other strains had less effect on cell
division but permitted the appearance of several abnormalities through different
mitotic stages. In general, chromosomal aberrations were more obvious with
metabolites of Aspergillus species, Mucor circinelloides and Cladosporium
cladosporioides. The mutagenic effects produced by these fungal metabolites
reflect the risk that might take place through the consumption of these
contaminated feedstuffs.

PMID: 2746472 [PubMed /​ indexed for MEDLINE]

448: Acta Pol Pharm. 1989;46(3):295/​300.

[Study of the cytostatic activity of various derivatives of 2/​quinolinohydrazine
and S/​triazolo[4,3/​a]quinoline]

[Article in Polish]

Soltysiak M, Santus M.

Antimitotic action of nine derivatives of 2/​quinolinohydrazine and nine
derivatives of s/​triazolo[4,3/​a]quinoline was examined in comparison with that
of isonicotinic acid hydrazide. The Levan's cytological method, consisting in
observation of disturbances in mitotic activity in meristematic cells of Allium
cepa L. roots, was employed.

Publication Types:
English Abstract
In Vitro

PMID: 2618773 [PubMed /​ indexed for MEDLINE]

449: Cell Mol Biol. 1989;35(4):367/​71.

Effects of helio/​neon laser radiation upon cellular cycle in a plant model.

de Barioglio SR, Fiol de Cuneo M, Lacuara JL, Juri H.

The scope of this study was to investigate possible relationships between
He/​Neon laser radiation and mitotic and phase indices in meristematic cells of
Allium cepa L. bulbs. Our results indicate that mitotic index increased after
irradiation depending this modification on the time exposure and the potency of
the He/​Neon beam. Phase indices were also modified: frequency of prophase
increased, while inter/​ meta/​ and anaphase decreased: telophases remain
unchanged. These variations were significative only when the preparations were
irradiated a) with 5 mW for 10 min. or more, b) with 10 mW or c) when the
preparations were processed 60 min. after irradiation. These findings could not
be attributed to thermal changes. Modifications in RNA or protein synthesis
could be responsible.

PMID: 2611826 [PubMed /​ indexed for MEDLINE]

450: Planta Med. 1988 Dec;54(6):560.

New Biologically Active Sulfur/​Containing Compounds from Allium cepa.

Bayer T, Wagner H, Dorsch W.

Institute of Pharmaceutical Biology, Karlstr. 29, D/​8000 Munchen 2, Federal
Republic of Germany.

PMID: 17265341 [PubMed /​ in process]

451: Plant Physiol. 1988 Jul;87(3):622/​628.

In Vivo Perturbation of Membrane/​Associated Calcium by Freeze/​Thaw Stress in
Onion Bulb Cells : Simulation of This Perturbation in Extracellular KCl and
Alleviation by Calcium.

Arora R, Palta JP.

Department of Horticulture, University of Wisconsin, Madison, Wisconsin 53706.

Incipient freeze/​thaw stress in onion bulb scale tissue is known to cause
enhanced efflux of K(+), along with small but significant loss of cellular
Ca(2+). During the post/​thaw period, irreversibly injured cells undergo a
cytological aberration, namely, ;protoplasmic swelling.' This cellular symptom
is thought to be caused by replacement of Ca(2+) from membrane by extracellular
K(+) and subsequent perturbation of K(+) transport properties of plasma
membrane. In the present study, onion (Allium cepa L. cv Sweet Sandwich) bulbs
were slowly frozen to either /​8.5 degrees C or /​11.5 degrees C and thawed over
ice. Inner epidermal peels from bulb scales were treated with fluorescein
diacetate for assessing viability. In these cells, membrane/​associated calcium
was determined using chlorotetracycline fluorescence microscopy combined with
image analysis. Increased freezing stress and tissue infiltration (visual
water/​soaking) were paralleled by increased ion leakage. Freezing injury (/​11.5
degrees C; irreversible) caused a specific and substantial loss of
membrane/​associated Ca(2+) compared to control. Loss of membrane/​associated
Ca(2+) caused by moderate stress (/​8.5 degrees C; reversible) was much less
relative to /​11.5 degrees C treatment. Ion efflux and Ca(2+)/​chlorotetracycline
fluorescence showed a negative relationship. Extracellular KCl treatment
simulated freeze/​thaw stress by causing a similar loss of membrane/​associated
calcium. This loss was dramatically reduced by presence of extracellular
CaCl(2). Our results suggest that the loss of membrane/​associated Ca(2+), in
part, plays a role in initiation and progression of freezing injury.

PMID: 16666196 [PubMed /​ as supplied by publisher]

452: Mutagenesis. 1988 Jul;3(4):333/​5.

UV/​mediated toxic bioactivity of harmine in the meristematic cells of Allium
cepa.

Hazen MJ, Gutierrez/​Gonzalvez MG.

Departmento de Biologia, Unidad de Citologia e Histologia, Facultad de Ciencias,
Universidad Autonoma de Madrid, Spain.

The photodynamic effect of harmine and UV light was studied by measuring the
number of sister/​chromatid exchanges and micronuclei induced by this treatment
in Allium cepa meristematic cells. A significant increase in the frequencies of
both cytogenetic events was observed when proliferating cells were treated for 4
h with harmine followed by irradiation with UV light for 3 min.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 3062322 [PubMed /​ indexed for MEDLINE]

453: Mutat Res. 1988 Mar/​Apr;207(3/​4):135/​9.

Effect of copper coordination complexes on sister/​chromatid exchanges in plant
cells.

Hazen MJ, Juarranz A, Stockert JC, Gonzalez A, Beltran/​Porter D.

Departamento de Biologia, Facultad de Ciencias, Universidad Autonoma de Madrid,
Spain.

The effectiveness of several copper coordination complexes in the induction of
sister/​chromatid exchanges (SCE) in meristematic cells of Allium cepa roots was
studied. A significant increase in the frequencies of SCE was observed when
cells were exposed to different concentrations of copper complexes for 3 h. This
effect, which is concentration dependent, seems to be related to the possibility
of intercalative binding modes between the planar copper complexes and DNA.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 3357489 [PubMed /​ indexed for MEDLINE]

454: Yao Xue Xue Bao. 1988 Jan;23(1):8/​11.

[Effect of Allium cepa L. var. agrogatum Don and Allium macrostemon Bunge on
arachidonic acid metabolism]

[Article in Chinese]

Yg G, Liu YY, Yang XH, Chen D, Fu FH.

Publication Types:
English Abstract
Research Support, Non/​U.S. Gov't

PMID: 3400480 [PubMed /​ indexed for MEDLINE]

455: Symp Soc Exp Biol. 1988;42:181/​201.

Temperature and the cell cycle.

Francis D, Barlow PW.

School of Pure and Applied Biology, University of Wales, Cardiff, UK.

During the period between successive divisions, a cell traverses three stages of
interphase: G1 (pre/​synthetic interphase), S/​phase (DNA synthetic interphase)
and G2 (post/​synthetic interphase). The time taken for all cells in a meristem
to divide (the cell doubling time (cdt] decreases in response to an increase in
temperature. For example, the cdt in root meristems of Zea mays decreases
21/​fold as the temperature is increased from 3 to 25 degrees C. Whether all
phases of the cell cycle alter proportionately with temperature has been
ascertained by comparing data from the root meristem of five species: Pisum
sativum, Helianthus annuus, Tradescantia paludosa, Allium cepa and Triticum
aestivum. In three of the five species there is a disproportionate lengthening
of the G1 phase at low temperatures. We suggest that arrest in G1 with the
associated 2C amount of DNA, confers maximal protection on the genome of a
somatic cell to the stress of low temperature. DNA replication has been studied
at different temperatures for Helianthus annuus, Secale cereal and Oryza sativa.
The rate of DNA replication, per single replication fork, increases when the
temperature is raised, while the distance between initiation points (replicon
size) remains constant. The temperature at which the cell cycle has a minimum
duration is close to 30 degrees C in many species, and it seems that this
optimum temperature is always near the upper temperature limit of the cell
cycle. The rate of cell division determines the rates of organ and cell growth.
Thus, temperature has a major effect on the way in which meristematic cells are
deployed in organogenesis. The rate of organogenesis, in turn, determines the
response of the plant to the growing season. We predict that species growing in
sub/​arctic conditions comprise cells with low DNA contents and hence have the
potentialities for rapid cell cycles so that maximum advantage can be taken of a
short growing season. Data from Triticum aestivum show that at 5 degrees C,
nucleoli are large compared with those at 10/​25 degrees C. These observations
are consistent with high levels of RNA polymerase and cellular RNA found at low
compared with high temperatures. These responses may be important in sustaining
growth at 5 degrees C. Finally, the effects of temperature on developmental
transitions are discussed. The picture that emerges is that more is known about
low, as opposed to high, temperature as a morphogenetic switch but virtually
nothing is known about cell cycle activity during such transitions.(ABSTRACT
TRUNCATED AT 400 WORDS)

Publication Types:
Research Support, Non/​U.S. Gov't
Review

PMID: 3077857 [PubMed /​ indexed for MEDLINE]

456: Histochemistry. 1988;89(2):199/​200.

Harmine as a substitute for 33258 Hoechst in the FPG technique.

Gutierrez/​Gonzalvez MG, Hazen MJ, Espelosin RH.

Departamento de Biologia, Facultad de Ciencias, Universidad Autonoma de Madrid,
Spain.

We studied the effectiveness of harmine as a substitute for 33258 Hoechst in the
fluorescence/​plus/​Giemsa technique, using Allium cepa chromosomes after
5/​bromo/​2'/​deoxyuridine (BrdU) incorporation. Harmine showed a photosensitizing
capacity which was somewhat higher than 33258 Hoechst and used half of the time
established for the usual treatment.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2456279 [PubMed /​ indexed for MEDLINE]

457: Lymphokine Res. 1988 Spring;7(1):49/​59.

The physiological interferon response. IX. Interferon activity in rabbit lymph
after intraduodenal administration of alimentary lectins.

Bocci V, Paulesu L, Pessina GP, Nicoletti C.

Institute of General Physiology, University of Siena, Italy.

The physiological interferon (IFN) response involves the production of little
amounts of IFN in localized lymphoid microenvironments upon induction of
exogenous and endogenous inducers. The aim of this work was to demonstrate
whether dietary antigens and/or alimentary lectins could induce IFN in vivo
after intraduodenal administration in rabbits. For this purpose we have
collected simultaneously the abdominal lymph and plasma during the experiments
for about 12 hours. The results show that while both onion' (Allium cepa) and
cucumber' (Cucumis sativum) homogenates are ineffective, the hydrolysate of the
latter induces a marked increase of IFN in the lymph suggesting that preliminary
digestion (and probably gastric digestion) is crucial for the activation of IFN
inducers. The maximum IFN activity occurs 7 hours after the administration and
there is no concomitant activity in the plasma. Addition of bile salts to either
the homogenates or the hydrolysates in unable to modify the pattern of the
response. Preliminary characterization of the IFN activity has shown it to be
trypsin/​sensitive acid/​ and heat/​stable and species/​specific.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2452325 [PubMed /​ indexed for MEDLINE]

458: Stain Technol. 1988 Jan;63(1):27/​31.

Silver staining of the nucleolar organizer regions (NORs) in semithin Lowicryl
sections.

Moreno FJ, Villamarin A, Garcia/​Herdugo G, Lopez/​Campos JL.

Department of Cell Biology, Faculty of Biology, University of Seville, Spain.

The one/​step silver technique was applied to semithin Lowicryl sections of root
meristem cells of Allium cepa and a human tumor cell line (TG cells). In vegetal
cells, after 5 min of staining reaction, the Ag/​NOR proteins formed ring/​shaped
structures peripherally within the nucleolus. In animal cells silver granules
were distributed over the entire nucleolus. The specificity of the staining
reaction was increased by incubation of the sections in NH4Cl and Schiff's
reagent prior to Ag/​NOR silver staining.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2451325 [PubMed /​ indexed for MEDLINE]

459: Planta Med. 1987 Dec;53(6):573/​574.

On the Occurrence of Kaempferol/​4'/​O/​beta/​D/​glucopyranoside in Filipendula
ulmaria and Allium cepa.

Scheer T, Wichtl M.

Institut fur Pharmazeutische Biologie, Deutschhausstr. 17 1/2, D/​3550
Marburg/Lahn, Bundesrepublik Deutschland.

In addition to the main flavonol glycoside spiraeoside in bulbs of ALLIUM CEPA
L., kaempferol/​4'/​glucoside ( 1) has been found in smaller amounts. Traces of
other flavonoids could be detected also.

PMID: 17269103 [PubMed /​ as supplied by publisher]

460: Plant Physiol. 1987 Dec;85(4):1079/​1083.

The C/​S Lyases of Higher Plants : Direct Comparison of the Physical Properties
of Homogeneous Alliin Lyase of Garlic (Allium sativum) and Onion (Allium cepa).

Nock LP, Mazelis M.

Department of Food Science and Technology, 1480 Chemistry Annex, University of
California, Davis, California 95616.

Garlic and onion alliin lyases, although from closely related species, have many
differences. The two enzymes differ in their K(m) values, pH optima, and
isoelectric points. There is a major difference in their molecular weight and
subunit structure. The garlic holoenzyme has a molecular weight of 85,000 and
consists of two subunits of molecular weight 42,000. The onion enzyme has a
holoenzyme molecular weight of 200,000 composed of four subunits of molecular
weight 50,000. The onion enzyme is much more difficult to dissociate into its
subunits which suggests differences in subunit interaction between the two
enzymes. The dimeric stucture of the garlic and the tetrameric structure of the
onion enzyme is consistent with a coenzyme content (pyridoxal/​5'/​phosphate)
equivalent to one mole per subunit. The two enzymes vary vastly in their
spectra, the onion enzyme having a lower pyridoxal/​5'/​phosphate absorbance at
430 nanomoles and an inability to react with l/​cysteine. Both enzymes are
glycoproteins and bind to concanavalin A/​Sepharose columns. The onion alliin
lyase binds more tightly than the garlic enzyme. The amino acid content of both
enzymes is similar as is the carbohydrate content. However, upon hydrolysis the
onion lyase does yield more mannose units than the garlic enzyme which is
consistent with the former's stronger affinity for concanavalin A.

PMID: 16665807 [PubMed /​ as supplied by publisher]

461: Mutat Res. 1987 Oct;192(2):125/​30.

Factors affecting the production of SCEs by maleic hydrazide in root/​tip
chromosomes of Allium cepa.

Cortes F, Escalza P, Mateos S, Diaz/​Recasens M.

Departamento de Citologia e Histologia Vegetal y Animal, Facultad de Biologia,
Sevilla, Spain.

We have investigated the influence of pH on the induction of chromatid/​type
aberrations and sister/​chromatid exchanges (SCEs) by maleic hydrazide (MH) in
root/​tip cells of Allium cepa. For both cytogenetic endpoints, the lower the pH
of the treatment solution, the higher were the frequencies of chromosome
alterations detected at metaphase. We have further studied the persistence of
lesions giving rise to SCEs during successive cell cycles, as well as the
influence of BrdU concentration in the post/​treatment medium on the yield of
MH/​induced SCEs. Our results suggest that the cytogenetic action of MH in many
respects resembles that of bifunctional alkylating agents.

PMID: 3657841 [PubMed /​ indexed for MEDLINE]

462: Mutat Res. 1987 Oct;180(2):183/​8.

Effects of caffeine and inhibitors of DNA synthesis on chromatid/​type
aberrations induced by acetaldehyde in root/​tip cells.

Cortes F, Mateos S, Ortiz T, Pinero J.

Departamento de Citologia e Histologia Vegetal y Animal, Facultad de Biologia,
Sevilla, Spain.

Root/​tip cells of Allium cepa were exposed to acetaldehyde (AA) and post/​treated
with caffeine and 3 inhibitors of DNA synthesis, namely hydroxyurea (HU),
5/​fluorodeoxyuridine (FdUrd), and arabinofuranosylcytosine (araC). Caffeine
strongly potentiated the frequency of chromatid/​type aberrations when given
immediately after the AA treatment or as a 5/​h treatment starting 10 h before
the addition of colchicine. In contrast, no enhancement was observed when
caffeine was present for the last 2.5 h, simultaneously with colchicine. The
inhibitors of DNA synthesis were given following this last schedule. Both HU and
FdUrd clearly enhanced the yield of AA/​induced chromatid aberrations, while no
enhancement of chromosome damage was observed after exposure to araC.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2958705 [PubMed /​ indexed for MEDLINE]

463: Prev Med. 1987 Sep;16(5):670/​85.

Garlic (Allium sativum) and onion (Allium cepa): a review of their relationship
to cardiovascular disease.

Kendler BS.

Department of Biology, Manhattan College, Riverdale, New York 10471.

Garlic and onion have been used for millenia in the traditional medical practice
of many cultures to treat cardiovascular and other disorders. Both Allium
species, their extracts, and the chemical constituents of these plants have been
investigated for possible effects on cardiovascular disease risk factors/​/​both
definite (hyperlipidemia, hypertension and hyperglycemia) and suspected
(platelet aggregation and blood fibrinolytic activity). Action of these Allium
species on blood coagulability is more clearly defined than their effect on the
other risk factors. While many of the studies have serious methodological
shortcomings, there is some evidence to suggest that use of certain formulations
of garlic and/or onion is accompanied by favorable effects on risk factors in
normal subjects and in patients with atherosclerotic disease. The possibility of
toxicity resulting from acute and chronic ingestion of large amounts of these
plants or their extracts is unresolved. Accordingly, further clinical and
epidemiological studies are required before the role of these plants in the
prevention and control of cardiovascular disorders is understood and can be
realized. Additional research in this area is recommended.

Publication Types:
Review

PMID: 3317392 [PubMed /​ indexed for MEDLINE]

464: Plant Physiol. 1987 Aug;84(4):1088/​1095.

Influence of Internal Sugar Levels on Apoplasmic Retrieval of Exogenous Sucrose
in Source Leaf Tissue.

Wilson C, Lucas WJ.

Botany Department, University of California, Davis, California 95616.

Sugar levels in Beta vulgaris leaves were increased by heat/​girdling the petiole
and returning the plant to the controlled/​environment chamber for 10 and 34
hours. After 10 hours, sucrose influx into the treated leaves was similar to the
controls, although sucrose levels increased from 2.1 to 5.3 micromoles per
milligram chlorophyll. However, after a 34/​hour treatment, sucrose levels
increased from 2.1 to 11.5 micromoles per milligram chlorophyll. In this
instance, sucrose influx decreased relative to the untreated controls.
Decreasing sugar levels by DCMU treatment resulted in a small stimulation of
sucrose influx. A similar DCMU treatment applied to leaves of Allium cepa also
resulted in an increase in sucrose influx. However, in A. cepa we could not
attribute this increase to a lowering of sugar levels, as the kinetic profiles
obtained from control leaves did not vary from each other throughout the day,
despite considerable changes in sugar levels. Additionally, it appeared that
sucrose uptake in onion may be set at some point and remains invariant
throughout the day. Similar studies were also conducted on discs cut from mature
leaves of Spinacia oleracea var America. Between 1 and 8 hours after the onset
of the photoperiod, the sucrose content of the spinach leaves increased from 2.6
to 9.3 micromoles per milligram chlorophyll. A comparison of the kinetic
profiles obtained from leaf discs, taken at these times, indicated that sucrose
uptake was not influenced by these changes in internal sugar levels. The
relationship between the above findings and ;trans' inhibition of exogenous
sucrose uptake is discussed. Although intermediate changes in sugar levels in
sugar beet leaves did not appear to affect sucrose influx, autoradiographic
studies revealed that these changes dramatically affected the partitioning of
exogenously supplied [(14)C]sucrose. Our results indicate that while
intermediate changes in internal sugar levels have little effect on sucrose
influx across the plasmalemma, they may dramatically affect partitioning between
the phloem and the mesophyll vacuole.

PMID: 16665567 [PubMed /​ as supplied by publisher]

465: J Cell Sci. 1987 Jun;87 ( Pt 5):635/​41.

Regulation of G2 by cell size contributes to maintaining cell size variability
within certain limits in higher plants.

Navarrete MH, Cuadrado A, Escalera M, Canovas JL.

Centro de Investigaciones Biologicas, CSIC, Madrid, Spain.

The variability of (1) surface area projection (size) at which cells terminate
DNA replication, (2) the area at which they initiate mitosis, (3) the area at
which they divide, (4) the duration of G2, and (5) the duration of G2 plus
mitosis (in fact, prophase + metaphase + anaphase) has been estimated in
steady/​state cell populations of Allium cepa root meristems. The coefficient of
variation of cell area at termination of DNA synthesis was found to be 14% while
the coefficient of variation of cell area at mitosis initiation was 13%. As
there is also a substantial variability of G2 (the coefficient of variation was
estimated to be 38%), the combination of these data indicates that cell size
regulation of G2 contributes to maintaining cell size variability (and therefore
DNA concentration) within certain limits. Mitosis also varies but less than G2
(the coefficient of variation of G2 + mitosis was found to be 31%). As the
coefficient of variation of cell area at division (14%) is hardly larger than
the coefficient of variation of cell area at initiation of mitosis, it can be
suggested that coordination between cell size and mitosis duration helps to
avoid a significant increase in the variability of cell size at the end of the
division cycle.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 3667721 [PubMed /​ indexed for MEDLINE]

466: J Cell Biol. 1987 Jun;104(6):1515/​9.

Actin in the preprophase band of Allium cepa.

Palevitz BA.

F/​actin has been identified in the preprophase band of Allium cepa. Cells
attached to subbed slides were obtained from formaldehyde/​fixed root tips
digested in EGTA and Cellulysin. The air/​dried cells were extracted in Triton
X/​100, treated with rhodamine/​phalloidin, rinsed briefly in PBS, and viewed in
the fluorescence microscope. Interphase cells contain a network of actin fibers
that extends into all areas of the cytoplasm. During preprophase, the network is
replaced by a band of fibers aligned in the position of the preprophase band.
Colocalization of F/​actin with rhodamine/​phalloidin and microtubules with
tubulin immunocytochemistry confirms that the two bands are coincident. The
actin appears to comprise a thin layer of fibers next to the plasmalemma. Like
the microtubule preprophase band, the actin band narrows as preprophase
progresses and disappears by midprophase. Fluorescent actin bands are not seen
in fixed cells pretreated with excess unlabeled phalloidin before staining. They
are also absent in roots exposed to cytochalasins B and D before fixation, but
preprophase band microtubules at all stages of aggregation are still present.
Colchicine treatment leads to the loss of both preprophase band microtubules and
actin. The possible function of preprophase band actin is discussed.

Publication Types:
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 3294855 [PubMed /​ indexed for MEDLINE]

467: Plant Physiol. 1987 Apr;83(4):768/​771.

A Comparative Analysis of Fructose 2,6/​Bisphosphate Levels and Photosynthate
Partitioning in the Leaves of Some Agronomically Important Crop Species.

Sicher RC, Baysdorfer C, Kremer DF.

United States Department of Agriculture, Agricultural Research Service,
Beltsville, Maryland 20705.

Starch, sucrose, and fructose 2,6/​bisphosphate (F2, 6BP) levels were measured in
pea (Pisum sativum L.), maize (Zea mays L.), onion (Allium cepa L.) and soybean
(Glycine max L.) leaves throughout a light/dark cycle. Leaf starch accumulated
in pea, maize, and soybean but not in onion. Sucrose was a major leaf storage
reserve in pea, maize, and onion but was only found at low levels in soybean. In
all species examined, the most dramatic changes in F2,6BP concentration
coincided with light/dark transitions. During the light period F2,6BP levels
were about 0.1 nanomole/milligram chlorophyll in soybean source leaves and there
was a small increase in effector concentration in the dark. Levels of F2,6BP
were also low in pea and maize leaves during the light period but then increased
10/​ or 20/​fold in the dark. Dark onion leaf F2,6BP levels were about 1.1 to 1.3
nanomole/milligram chlorophyll and these values decreased by 20 to 30% in the
light. Thus, three different patterns were identified that describe diurnal
F2,6BP levels in source leaves. These results support the suggestion that F2,6BP
is involved in the regulation of sucrose biosynthesis. However, it was not
possible to demonstrate that high levels of F2,6BP are essential for starch
synthesis in the chloroplast.

PMID: 16665336 [PubMed /​ as supplied by publisher]

468: Mutat Res. 1987 Feb;190(2):153/​7.

Clastogenic evaluation of cathinone and amphetamine in somatic cells of mice.

Tariq M, Parmar NS, Qureshi S, el/​Feraly FS, Al/​Meshal IA.

Clastogenic effects of cathinone, the active principle from khat (Catha edulis)
and amphetamine, a compound having similar chemical structure and
pharmacological activity, have been studied on the somatic cells of mice. Both
of them produced marked clastogenic activity and affected the cell proliferation
in the bone marrow of mice. They induced a significant increase in the frequency
of micronucleated polychromatic erythrocytes at higher doses. These results
substantiate our earlier observations on the clastogenic and mitodepressive
activity of cathinone on the meristematic region of Allium cepa, and indicate
that cathinone may be responsible for the mutagenic effect of khat reported by
other workers. The clastogenic effects of amphetamine are being reported for the
first time. Further studies are required to substantiate these findings and to
study whether cathinone and amphetamine produce a direct clastogenic effect or
whether they act as spindle poisons.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 3821773 [PubMed /​ indexed for MEDLINE]

469: Exp Cell Res. 1987 Feb;168(2):507/​17.

The incorporation of deoxyuridine monophosphate into DNA increases the
sister/​chromatid exchange yield.

Pardo EG, Hernandez P, Gutierrez C.

The effect of a treatment with 5/​fluoro/​2'/​deoxyuridine (FdUrd) in combination
with 2'/​deoxyuridine (dUrd) on cell proliferation, incorporation of DNA
precursors into DNA and sister/​chromatid exchanges (SCEs) has been analyzed in
Allium cepa meristem cells. FdUrd in the range 10(/​9)/​5 X 10(/​7) M produced a
dose/​ and time/​dependent decrease in the amount of cells in mitosis. This
inhibitory effect could be reversed by 70/​80% in short/​term (6 h) experiments,
by exogenously supplied dUrd at a concentration of 10(/​4) M. However, at the
highest FdUrd dose tested (10(/​7) M), 10(/​4) M dUrd could not reverse the FdUrd
effect in long/​term experiments (20 h, about one cell cycle interval), as shown
by analyzing the kinetics of synchronous cell populations. DNA extracted from
cells pulsed with [6/​3H]dUrd in the presence of FdUrd and 6/​amino/​uracil (6/​AU),
an inhibitor of uracil/​DNA glycosylase, contained a small amount of label (at
least 3% of the total radioactivity incorporated into DNA) in the form of
[6/​3H]dUMP. Thus, we conclude that, under our experimental conditions,
exogenously supplied dUrd may be metabolized intracellularly to 2'/​deoxyuridine
triphosphate (dUTP) and that this deoxynucleotide may eventually be
mis/​incorporated into DNA. As far as the formation of SCEs is concerned,
analysis of second division chromosomes showed that 2'/​deoxyuridine
monophosphate (dUMP) residues present in newly/​synthesized DNA strands are
probably not relevant to SCE formation. However, by analyzing SCE levels in
third division chromosomes of cells treated with FdUrd and dUrd during their
second cycle, we have scored a 6/​fold increase in the reciprocal SCE level which
demonstrates that the replication of a dUMP/​containing DNA template leads to a
higher SCE yield.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 2948827 [PubMed /​ indexed for MEDLINE]

470: Toxicon. 1987;25(4):451/​4.

Mitodepressive effect of (/​)/​cathinone, from Catha edulis (khat), on the
meristematic region of Allium cepa root tips.

Al/​Meshal IA.

(/​)/​Cathinone, a psychostimulant alkaloid from khat, showed a significant
mitodepressive effect on the dividing cells of Allium cepa root tips. This
effect was dose/​dependent and irreversible. Exposure of root cell to cathinone
for 48 hr produced significant condensation and clumping of chromosomes, sticky
metaphases and anaphase bridges. Our study suggests that the teratogenic and
mutagenic effects of khat extracts as reported by earlier workers might be
partially or totally due to their (/​)/​cathinone content.

PMID: 3617083 [PubMed /​ indexed for MEDLINE]

471: Plant Physiol. 1986 Oct;82(2):625/​629.

Protoplasmic Swelling as a Symptom of Freezing Injury in Onion Bulb Cells : Its
Simulation in Extracellular KCl and Prevention by Calcium.

Arora R, Palta JP.

Department of Horticulture, University of Wisconsin, Madison, Wisconsin 53706.

Freezing injury, in onion bulb tissue, is known to cause enhanced K(+) efflux
accompanied by a small but significant loss of Ca(2+) following incipient
freezing injury and swelling of protoplasm during the postthaw secondary injury.
The protoplasmic swelling of the cell is thought to be caused by the passive
influx of extracellular K(+) into the cell followed by water uptake. Using outer
epidermal layer of unfrozen onion bulb scales (Allium cepa L. cv Big Red), we
were able to stimulate the irreversible freezing injury symptoms, by bathing
epidermal cells in 50 millimolar KCl. These symptoms were prevented by adding 20
millimolar CaCl(2) to the extracellular KCl solution. Our results provide
evidence that loss of cellular Ca(2+) plays an important role in the initiation
and the progression of freezing injury.

PMID: 16665083 [PubMed /​ as supplied by publisher]

472: Mutat Res. 1986 Oct;164(5):327/​33.

Relationship of chromosomal damage induced by caffeine to growth temperature and
ATP level in proliferating cells.

Hernandez P, Mingo R, Gonzalez/​Fernandez A, Lopez/​Saez JF.

Caffeine is known to induce chromosomal aberrations in proliferating cells when
they are incubated during G2 and mitotic prophase. In the present paper, this
caffeine effect has been analyzed in Allium cepa root meristems growing at
different culture temperatures under steady/​state kinetics. Caffeine (1/​10 mM)
induces chromosomal aberrations in a dose/​dependent manner, and the treatment
efficiency correlates linearly with the square of caffeine concentration. The
efficiency of caffeine incubations, within the range 5/​25 degrees C during
equivalent cycle time periods has also been studied. It has been found that the
lower the culture temperature, the higher the level of chromosomal aberrations.
Moreover, at different temperatures, the level of chromosomal aberrations is a
simple function of caffeine concentration and the ATP level. Therefore, the
efficiency of caffeine treatment appears to be determined by some interaction
between caffeine concentration and cellular ATP level. Our present results
demonstrate that the influence of growth temperature on the chromosome/​breaking
effect of caffeine can be, at least partially, explained by the ATP levels
during the incubation periods. In short, under different kinetics of plant cell
proliferation, the ATP level, and/or something correlating with it, could
explain the efficiency of caffeine in inducing chromosomal aberrations: the
lower the ATP level, the higher the caffeine efficiency.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 3773927 [PubMed /​ indexed for MEDLINE]

473: J Cell Biol. 1986 Jun;102(6):1995/​2005.

Metabolic inhibitors block anaphase A in vivo.

Hepler PK, Palevitz BA.

Anaphase in dividing guard mother cells of Allium cepa and stamen hair cells of
Tradescantia virginiana consists almost entirely of chromosome/​to/​pole motion,
or anaphase A. Little or no separation of the poles (anaphase B) occurs.
Anaphase is reversibly blocked at any point by azide or dinitrophenol, with
chromosome motion ceasing 1/​10 min after application of the drugs. Motion can be
stopped and restarted several times in the same cell. Prometaphase, metaphase,
and cytoplasmic streaming are also arrested. Carbonyl cyanide m/​chlorophenyl
hydrazone also stops anaphase, but its effects are not reversible. Whereas the
spindle collapses in the presence of colchicine, the chromosomes seem to
"freeze" in place when cells are exposed to respiratory inhibitors. Electron
microscope examination of dividing guard mother cells fixed during azide and
dinitrophenol treatment reveals that spindle microtubules are still present. Our
results show that chromosome/​to/​pole motion in these cells is sensitive to
proton ionophores and electron transport inhibitors. They therefore disagree
with recent reports that anaphase A does not require a continuous supply of
energy. It is possible, however, that anaphase does not directly use ATP but
instead depends on the energy of chemical and/or electrical gradients generated
by cellular membranes.

Publication Types:
Research Support, U.S. Gov't, Non/​P.H.S.
Research Support, U.S. Gov't, P.H.S.

PMID: 3711141 [PubMed /​ indexed for MEDLINE]

474: Plant Physiol. 1986 May;81(1):253/​258.

Reversal of Abscisic Acid/​Induced Stomatal Closure by trans/​Cinnamic and
p/​Coumaric Acid.

Laloraya MM, Nozzolillo C, Purohit S, Stevenson L.

Department of Life Sciences, Devi Ahilya Vishwavidyalaya, Indore (M.P.) India.

Abscisic acid (ABA)/​induced increase in stomatal diffusive resistance (SDR) in
excised leaves of bean (Phaseolus vulgaris L. cv Pencil Pod) and maize (Zea mays
L. cv Golden Bantam) is inhibited by low concentrations of trans/​cinnamic acid
(TCA) (1 micromolar) and p/​coumaric acid (PCA) (10 micromolar) when given
together with ABA (10 micromolar) in the transpiration stream through the cut
end of the petiole or leaf blade. A concentration effect is observed both in the
ABA action and its reversal by phenolic acids. Leaves having attained a high
diffusive resistance in ABA solution recover rapidly when transferred to water.
ABA (10 micromolar) induced closure of the stomata in onion, Allium cepa L. and
Vicia faba epidermal peels. This is associated with loss of K(+) from guard
cells. In the presence of TCA (10 micromolar) and PCA (10 micromolar) K(+) is
retained in the guard cells with open stomata. The dark closure of stomata is
also inhibited by TCA and PCA. It is suggested that these phenolic acids may
inhibit the ABA effect by competing with or acting on some ABA/​specific site,
probably located on the plasma membrane, regulating flux of K(+) ions. A weak
association of ABA with the plasma membrane is envisaged because of the rapid
recovery obtained upon transferral of the leaves to water.

PMID: 16664784 [PubMed /​ as supplied by publisher]

475: Plant Physiol. 1986 Mar;80(3):702/​706.

The C/​S Lyases of Higher Plants : Isolation and Properties of Homogeneous
Cystine Lyase from Broccoli (Brassica oleracea var botrytis) Buds.

Hamamoto A, Mazelis M.

Department of Food Science and Technology, University of California, Davis
95616.

Cystine lyase degrades l/​cystine by a beta/​elimination to form cysteine
persulfide, pyruvate, and ammonia. This enzyme is common in Brassica sp. and has
been purified to homogeneity from extracts of broccoli (Brassica oleracea var
botrytis) buds. Two isozymes were separated on DEAE/​Fractogel columns and the
first peak, cystine lyase I further purified to homogeneity. The purified enzyme
had a narrow range of substrate specificity with l/​cystine and
S/​alkyl/​l/​cysteine sulfoxides being the primary substrates. The K(m) for
l/​cystine was 1.9 millimolar and for S/​ethyl/​l/​cysteine sulfoxide was 15.6
millimolar, suggesting that l/​cystine would be preferred in vivo. Using gel
filtration and sodium dodecyl sulfate/​polyacrylamide gel electrophoresis the
molecular weight of the holoenzyme was estimated as 152,000 composed of subunits
of approximately 49,000. This strongly suggests the native enzyme is a trimer.
The presence of carbohydrate in the native enzyme was detected at the level of
5.8% on a weight basis. Except for the ability to utilize l/​cystine as a
substrate there are many similarities between cystine lyase I and the alliin
lyase of onion (Allium cepa).

PMID: 16664688 [PubMed /​ as supplied by publisher]

476: J Cell Sci. 1986 Feb;80:171/​80.

Cell proliferation in Allium cepa L. meristems under 8/​hydroxyquinoline, a
chelating agent that affects DNA and RNA polymerases.

Ferrero ML, De la Torre C.

8/​Hydroxyquinoline (HQ) chelates Mg2+ and Mn2+ and, secondarily, affects the
activities of DNA and RNA polymerases. The in vivo effect of HQ has been
estimated in Allium cepa L. meristems growing under new growth kinetics in the
presence of this agent. HQ (at both 5 X 10(/​5) M and 10(/​4) M) depressed
incorporation of [3H]uridine much more effectively than that of [3H]/​thymidine.
Cycle kinetics in meristems behaved as if they were independent of the rates of
synthesis or accumulation of RNA since, under HQ, cycle time was only moderately
modified and the new cycle kinetics achieved could be explained by the new rates
of [3H]thymidine incorporation. Lengthened S periods were partially compensated
for by shortened G2 phases, suggesting that, in these cells, both the growth
cycle and its coupling with the DNA/​division cycle were not disturbed by a
decreased amount of RNA. Finally, the nucleolar cycle during mitosis, but not
the interphase nucleolus, was modified under the new rates of RNA synthesis.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 3088000 [PubMed /​ indexed for MEDLINE]

477: Ann Bot (Lond). 1986;58:381/​7.

The possible involvement of root/​cap mucilage in gravitropism and calcium
movement across root tips of Allium cepa L.

Moore R, Fondren WM.

Department of Biology, Baylor University, Waco, Texas 76798, USA.

Roots of Allium cepa L. grown in aerated water elongate rapidly, but are not
graviresponsive. These roots (1) possess extensive columella tissues comprised
of cells containing numerous sedimented amyloplasts, (2) lack mucilage on their
tips, and (3) are characterized by a weakly polar movement of calcium (Ca)
across their tips. Placing roots in humid air correlates positively with the
(1) onset of gravicurvature, (2) appearance of mucilage on tips of the roots,
and (3) onset of the ability to transport Ca polarly to the lower side of the
root tip. Gravicurvature of roots previously submerged in aerated water is more
rapid when roots are oriented vertically for 1/​2 h in humid air prior to being
oriented horizontally. The more rapid gravicurvature of these roots correlates
positively with the accumulation of mucilage at the tips of roots during the
time the roots are oriented vertically. Therefore, the onset of gravicurvature
and the ability of roots to transport Ca to the lower sides of their tips
correlate positively with the presence of mucilage at their tips. These results
suggest that mucilage may be important for the transport of Ca across root caps.

Publication Types:
Research Support, Non/​U.S. Gov't
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 11538870 [PubMed /​ indexed for MEDLINE]

478: Comp Biochem Physiol C. 1986;85(1):163/​6.

Extraction and identification of different prostaglandins in Allium cepa.

Al/​Nagdy SA, Abdel Rahman MO, Heiba HI.

Green onions (Allium cepa) were homogenized in a blender and extracted by normal
extraction methods except that diethyl ether was used as the first extracting
solvent. Different analytical procedures were used for the identification of the
prostaglandins separated. TLC was applied using silica gel 60 F254 plates and a
mixture of benzene, dioxane and acetic acid (20:10:1) as eluent, and the Rf
values were compared with those of authentic samples. GC analysis on an SE 30
packed column and FID was applied; relative retention times of the onion extract
components were measured and matched with authentic prostaglandin samples using
cholesterol as an internal standard. GC/​MS analyses using the same conditions
adopted for GC analysis were conducted on a Finnigan MAT 112S instrument. Four
peaks were identified. The prostaglandins identified were F1 alpha, E1, B1 and
A2.

PMID: 2877782 [PubMed /​ indexed for MEDLINE]

479: Vet Rec. 1985 Nov 9;117(19):497/​8.

Onion poisoning of young cattle.

Verhoeff J, Hajer R, van den Ingh TS.

Eighty/​five cattle (calves and yearlings) were allowed 1000 kg of onions (Allium
cepa) a day. Signs of poisoning were observed after five days; 22 animals were
affected, one fatally. New illnesses continued to occur for five days after the
withdrawal of onions from the diet. Clinical signs included inappetance,
tachycardia, staggering and collapse, with jaundiced conjunctivae and
haemoglobinuria. Haemolytic anaemia with Heinz bodies in the red cells and
leucocytosis were demonstrated.

PMID: 4082398 [PubMed /​ indexed for MEDLINE]

480: Exp Cell Res. 1985 Nov;161(1):172/​80.

Inhibition of uracil/​DNA glycosylase increases SCEs in BrdU/​treated and visible
light/​irradiated cells.

Maldonado A, Hernandez P, Gutierrez C.

We have approached the study of the ability of different types of lesions
produced by DNA/​damaging agents to develop sister/​chromatid exchanges (SCEs) by
analyzing SCE levels observed in Allium cepa L cells with BrdU/​substituted DNA
and exposed to visible light (VL), an irradiation which produces uracil residues
in DNA after debromination of bromouracil and enhances SCE levels but only above
a certain dose. We have partially purified an uracil/​DNA glycosylase activity
from A. cepa L root meristem cells, which removes uracil from DNA, the first
step in the excision repair of this lesion. This enzyme was inhibited in vitro
by 6/​amino/​uracil and uracil but not by thymine. When cells exposed to VL, at a
dose that did not produce per se an SCE increase, were immediately post/​treated
with these inhibitors of uracil/​DNA glycosylase, a significant increase in SCE
levels was obtained. Moreover, SCE levels in irradiated cells dropped to control
level when a short holding time (less than 15 min) elapsed between exposure to
VL and the beginning of post/​treatment with the inhibitor. Thus, our results (1)
showed that inhibitors of uracil/​DNA glycosylase enhanced SCE levels in cells
with unifilarly BrdU/​substituted DNA exposed to visible light; (2) pointed to
uracils and/or to some products of their repair as lesions responsible for SCE
formation under our experimental conditions; and (3) indicated the existence of
a very rapid repair of SCE/​inducing lesions produced by visible light
irradiation of cells with unifilarly BrdU/​containing DNA.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 4054229 [PubMed /​ indexed for MEDLINE]

481: Plant Physiol. 1985 Sep;79(1):308/​310.

The Biosynthesis of the Pyrenocines in Cultures of Pyrenochaeta terrestris.

Sparace SA, Mudd JB.

ARCO Plant Cell Research Institute, Dublin, California 94568.

[(14)C]Acetate, [(14)C]formate, and methyl[(14)C]methionine all serve as
precursors of pyrenocines A, B, and C when added to cultures of Pyrenochaeta
terrestris (Hansen) Gorenz, Walker, and Larson, the pathogen responsible for
disease known as pink root of onion (Allium cepa L.). This information supports
the hypothesis that these metabolites are methyl/​substituted polyketides in
origin. Pyrenocine A arises from acetate via uncharacterized intermediates and
is subsequently converted to pyrenocine B. The biosynthetic role of pyrenocine C
remains uncertain.

PMID: 16664393 [PubMed /​ as supplied by publisher]

482: Cell Biol Int Rep. 1985 Aug;9(8):699/​708.

Response of interphasic nucleoli to hypoxia in root meristems.

Gimenez/​Abian MI, Rufas JS, de la Torre C.

Hypoxia produces structural changes in interphasic nucleoli of Allium cepa L.
root meristems. Following segregation, the fibrillar portion of nucleoli seems
to be extruded in masses, accessory bodies, which stay in nucleoplasm. Such
bodies apparently leave the fibrillar portion in places which seem to correspond
to insertion areas of the nucleolar organizers in nucleoli. Reversal of these
changes is rapidly obtained when oxygenation is restored. Accessory bodies
differ from prenucleolar bodies since they are compact and homogeneous and they
do not display segregation under hypoxia.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 4028197 [PubMed /​ indexed for MEDLINE]

483: Mutat Res. 1985 Aug;151(1):77/​82.

Induction of sister/​chromatid exchanges (SCEs) by 5/​fluorodeoxyuridine. The role
of 5/​bromodeoxyuridine incorporated into parental DNA.

Escalza P, Cortes F, Schvartzman JB.

The effect of thymidine (dT) and 5/​fluorodeoxyuridine (FdU) on the frequency of
sister/​chromatid exchanges (SCEs) was examined in root/​tip cells of Allium cepa.
dT was unable to induce SCEs at all the concentrations tested. In contrast, FdU
was efficient in the induction of SCEs. A nearly 3/​fold increase in the
frequency of SCEs was obtained with 5 X 10(/​7) M FdU when it was given
simultaneously with 5/​bromodeoxyuridine (BrdU) for 2 consecutive cell cycles.
Also, when FdU was present only for the first round of replication, the rate of
SCEs in M2 chromosomes was notably higher than when it was given only during the
second replication round. By analyzing M3 chromosomes treated during the second
replication round with FdU the results also supported the hypothesis that the
majority of the FdU/​induced SCEs arise as a consequence of a higher rate of BrdU
incorporation, and that most of them are formed when BrdU/​containing strands are
used as template for DNA synthesis.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 3160947 [PubMed /​ indexed for MEDLINE]

484: Biochem Biophys Res Commun. 1985 Jun 28;129(3):645/​50.

Structural studies on Allium cepa L. chromatin: enhanced stability of
internucleosome interactions in plant chromatin.

Moreno ML, Puigdomenech P, Palau J.

The pattern of micrococcal nuclease digestion of chromatin from different organs
of Allium cepa has been studied. The DNA from small oligonucleosomes appears to
be highly degraded and heterogeneous. In solutions of intermediate ionic
strength (0.15 M NaCl) histones H2A and H2B form dimers, however at high salt
concentrations (2 M NaCl) they tend to form complexes of higher order, such as
tetramers. It is proposed that a correlation exists between the ability of these
proteins to form tetramers and the particular stability of internucleosome
interactions.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 4015650 [PubMed /​ indexed for MEDLINE]

485: J Cell Sci. 1985 Jun;76:97/​104.

The effect of partial protein synthesis inhibition on cell proliferation in
higher plants.

Cuadrado A, Navarrete MH, Canovas JL.

Meristematic cells from Allium cepa L. roots can attain a steady state of growth
in the presence of anisomycin at concentrations that effectively reduce the rate
of protein synthesis. Under these conditions the lengths of cell cycle periods
increase but not in the same proportion as the generation time (t). Mitosis is
hardly affected and S period is slightly lengthened. G2 increases less in
proportion to t, while G1 is extended much higher in proportion to t. Natural
synchronous populations have been used to study cell cycle parameters during
transition from the physiological steady state to the new one created by the
presence of the drug. G2 was the same during transition as during steady/​state
growth. G1 was much shorter during transition. Average cell mass at division was
reduced, and a negative correlation was observed between the length of G2 and
the size of the cell at termination of DNA synthesis. We propose that in higher
plants, G2 length is regulated by cell mass at completion of DNA synthesis (G2
being shorter in big cells than in small cells), though there is no cell size
requirement for mitosis.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 4066798 [PubMed /​ indexed for MEDLINE]

486: Cell Biol Int Rep. 1985 May;9(5):479/​89.

Increased replication in plant nuclei, whose spread chromatin contains enlarged
nucleosomal linkers, is only partially due to a rise in the number of DNA
elongating chains.

Moreno ML, de la Torre C.

Dormant and proliferating meristems of Allium cepa L. roots were compared. In
vivo DNA synthesis was nine times higher in proliferating meristems, partially
due to a 2.5 times increase in the relative number of DNA elongating chains, as
estimated after the assay for 3H/​TTP incorporation in permeabilized cells.
Stereology done on conventional electronmicrographs showed that nucleoplasm was
nearly three times larger in nuclei of proliferating meristems, while the amount
of compact chromatin did not diminish but redistributed instead, resulting that
the chromatin/nucleoplasm interface increased. Finally, the nucleosomal linker
/​as seen after the spreading of the chromatin fibres/​ was larger and more
variable in proliferating than in dormant meristems.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 4016965 [PubMed /​ indexed for MEDLINE]

487: Prostaglandins. 1985 May;29(5):847/​65.

Isolation and identification of two isomeric trihydroxy octadecenoic acids with
prostaglandin E/​like activity from onion bulbs (Allium cepa).

Ustunes L, Claeys M, Laekeman G, Herman AG, Vlietinck AJ, Ozer A.

Two fractions with prostaglandin E/​like activity were isolated from onion
(Allium cepa) by using XAD/​2 adsorption, silicic acid column chromatography and
thin layer chromatography. The fractions were analyzed by gas
chromatography/mass spectrometry and were characterized as isomeric mixtures of
9,10,13/​trihydroxy/​11/​octadecenoic and 9,12,13/​trihydroxy/​10/​octadecenoic acid,
which are lipoxygenase metabolites of linoleic acid. Bio/​assay, for which
cascade superfusion was used and the rabbit coeliac and mesenteric arteries and
the rat fundus strip were employed as assay organs, was utilized to monitor the
bio/​active profile throughout the isolation procedures. The activity of 1
microgram of the pharmacologically active fractions T1 and T2 was found to be
equivalent to that of respectively 1.33 and 0.63 ng of prostaglandin E2.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 4011928 [PubMed /​ indexed for MEDLINE]

488: EMBO J. 1985 Mar;4(3):605/​11.

Monoclonal antibodies to antigens in the peribacteroid membrane from
Rhizobium/​induced root nodules of pea cross/​react with plasma membranes and
Golgi bodies.

Brewin NJ, Robertson JG, Wood EA, Wells B, Larkins AP, Galfre G, Butcher GW.

John Innes Institute, Colney Lane, Norwich NR4 7UH, UK.

Three rat hybridoma lines that produced monoclonal antibodies reacting with the
peribacteroid membrane from Pisum sativum were isolated, and these all appeared
to recognize the same antigenic structure. Using one of these monoclonal
antibodies, AFRC MAC 64, electron microscopy of immunogold/​stained thin sections
of nodule tissue revealed that the antigen, present in the peribacteroid
membrane, was also found in the plant plasma membranes and in the Golgi bodies,
but not in the endoplasmic reticulum. When peribacteroid membrane proteins were
separated by SDS/​polyacrylamide gel electrophoresis and transferred to
nitrocellulose by electro/​blotting, it was found that MAC 64 bound to a series
of protease/​sensitive bands that migrated in the mol. wt. range 50/​85 K. The
epitope was sensitive to periodate oxidation and its structure may therefore
involve the carbohydrate component of a membrane glycoprotein. We suggest that
this structure originates in the Golgi apparatus and is subsequently transferred
to the peribacteroid membranes and plasma membranes. The monoclonal antibody
also reacted with peribacteroid membranes from nodules of Vicia and lupin, and
with plasma membranes and Golgi membranes from uninfected plant cells, including
root tip cells from onion (Allium cepa), indicating that the antigen is highly
conserved in the plasma membranes of plant cells.

PMID: 15926221 [PubMed /​ indexed for MEDLINE]

489: Cell Biol Int Rep. 1985 Mar;9(3):237/​43.

The transition point for protein synthesis in late S/​G2 may be delayed by genome
bromosubstitution without affecting the time of entry into mitosis.

Gonzalez/​Fernandez A, Sans J, Aller P, de la Torre C.

Bromosubstitution for most of the S period in synchronous populations of Allium
cepa L. meristematic cells resulted in a delay in the late S/​G2 transition point
where protein synthesis is needed for later mitotic entrance to occur. This
retardation in the position of the transition point was not accompanied by the
expected delay in the entrance into mitosis, suggesting that such protein
synthesis is a requisite, but not a timer for prophase triggering.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 3986919 [PubMed /​ indexed for MEDLINE]

490: Ann Bot (Lond). 1985;56:173/​87.

Calcium movement, graviresponsiveness and the structure of columella cells and
columella tissues in roots of Allium cepa L.

Moore R.

Department of Biology, Baylor University, Waco, Texas 76798, USA.

Roots of Allium cepa L. cv. Yellow are differentially responsive to gravity.
Long (e.g. 40 mm) roots are strongly graviresponsive, while short (c.g. 4 mm)
roots are minimally responsive to gravity. Although columella cells of
graviresponsive roots are larger than those of nongraviresponsive roots, they
partition their volumes to cellular organelles similarly. The movement of
amyloplasts and nuclei in columella cells of horizontally/​oriented roots
correlates positively with the onset of gravicurvature. Furthermore, there is
no significant difference in the rates of organellar redistribution when
graviresponsive and nongraviresponsive roots are oriented horizontally. The
more pronounced graviresponsiveness of longer roots correlates positively with
(1) their caps being 9/​6 times more voluminous, (2) their columella tissues
being 42 times more voluminous, (3) their caps having 15 times more columella
cells, and (4) their columella tissues having relative volumes 4.4 times larger
than those of shorter, nongraviresponsive roots. Graviresponsive roots that are
oriented horizontally are characterized by a strongly polar movement of 45Ca2+
across the root tip from the upper to the lower side, while similarly oriented
nongraviresponsive roots exhibit only a minimal polar transport of 45Ca2+.
These results indicate that the differential graviresponsiveness of roots of A.
cepa is probably not due to either (1) ultrastructural differences in their
columella cells, (2) differences in the rates of organellar redistribution when
roots are oriented horizontally. Rather, these results indicate the
graviresponsiveness may require an extensive columella tissue, which, in turn,
may be necessary for polar movement of 45Ca2+ across the root tip.

Publication Types:
Comparative Study
Research Support, U.S. Gov't, Non/​P.H.S.

PMID: 11539692 [PubMed /​ indexed for MEDLINE]

491: Ann Pharm Fr. 1985;43(3):273/​9.

[Action of onion, Allium cepa L., on primary hemostasis in healthy volunteers
before and after absorption of a high/​fat meal]

[Article in French]

Doutremepuich C, Gamba G, Refauvelet J, Quilichini R.

Publication Types:
English Abstract

PMID: 4083692 [PubMed /​ indexed for MEDLINE]

492: Bull Environ Contam Toxicol. 1985 Jan;34(1):80/​8.

Chromosomal aberrations in onion (Allium cepa) induced by water chlorination
by/​products.

Al/​Sabti K, Kurelec B.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 3971062 [PubMed /​ indexed for MEDLINE]

493: Indian J Physiol Pharmacol. 1985 Jan/​Mar;29(1):43/​6.

Effect of quercetin and Albizzia saponins on rat mast cell.

Johri RK, Zutshi U, Kameshwaran L, Atal CK.

In the present work the effect of quercetin obtained from (Allium cepa).
Albizzia lebbek (crude extract of seeds) and a pure saponin fraction of Albizzia
has been studied on the mast cells in the mesentery and peritoneal fluid of rats
subjected to anaphylaxis. The results show a mast cell membrane stabilizing
effect of these test drugs.

Publication Types:
In Vitro

PMID: 3932203 [PubMed /​ indexed for MEDLINE]

494: Histochemistry. 1985;83(3):241/​4.

Photosensitizing dyes and fluorochromes as substitutes for 33258 Hoechst in the
fluorescence/​plus/​Giemsa (FPG) chromosome technique.

Hazen MJ, Villanueva A, Juarranz A, Canete M, Stockert JC.

Using Allium cepa chromosomes after 5/​bromo, 2'/​deoxyuridine (BrdU)
incorporation, we studied several acid and basic dyes and fluorochromes for
their potential as substitutes for 33258 Hoechst in the fluorescence/​plus/​Giemsa
(FPG) technique. All of the dyes and fluorochromes investigated showed a
photosensitizing capacity which was slightly lower than 33258 Hoechst in the
cases of daunomycin, phloxin, fluorescein, thioflavine T and nuclear fast red,
and somewhat higher in the case of eosin Y. Observation and cytophotometric
analysis of differentially Giemsa/​stained sister chromatids when eosin Y was
used as the photosensitizing agent revealed the unsubstituted chromatid to be
reddish violet in colour (absorption maximum, 550 nm), while the
BrdU/​substituted chromatid was blue or pale violet blue (absorption maximum, 580
nm). These results indicate that eosin Y is a useful photosensitizing dye which
could be used as a substitute for 33258 Hoechst in the FPG staining technique.

Publication Types:
Comparative Study
Research Support, Non/​U.S. Gov't

PMID: 2412994 [PubMed /​ indexed for MEDLINE]

495: J Cell Sci. 1984 Dec;72:295/​306.

The subcellular concentration of ions and elements in thin cryosections of onion
root meristem cells. An electron/​probe EDS study.

Cameron IL, Hunter KE, Smith NK.

Quantitative electron/​probe energy dispersive X/​ray microanalysis has, for the
first time, been accomplished at a subcellular level in plant tissue using
cryofixed and thin freeze/​dried cryosections. The subcellular concentrations of
Na+, Cl/​, K+, P, S, Mg2+ and Ca2+ were measured in mol/kg dry weight in two
types of root meristematic cells of the onion, Allium cepa. The cell wall of the
meristematic cells had much higher concentrations of K+ and Ca2+ than was found
in the intracellular compartments. Storage granules in the protoderm cells were
about 6/​12 times lower in P and were about four times higher in S as compared to
other intracellular compartments. Comparison between the concentrations of ions
and other elements in meristematic plant cells and in mouse cardiac myocytes
confirms that major differences in cytoplasmic Na+ and Cl/​ concentrations do
indeed exist between these cell types.

Publication Types:
Comparative Study
Research Support, U.S. Gov't, P.H.S.

PMID: 6533152 [PubMed /​ indexed for MEDLINE]

496: J Histochem Cytochem. 1984 Nov;32(11):1224/​30.

Distribution of calcium during interphase and mitosis as observed by ion
microscopy.

Chandra S, Harris WC Jr, Morrison GH.

The ion microscope, based on secondary ion mass spectrometry, has been used to
demonstrate the distribution of calcium in the root tip cells of two plant
species, Allium cepa and Vicia faba. Interphase nuclei showed higher intensities
of calcium than cytoplasm, while nucleoli exhibited higher calcium intensities
than the rest of the nucleoplasm. The chromosomes showed high intensities of
calcium at all stages of mitosis. Calcium was also detected in the cell plate
and phragmoplast region of dividing cells. It appears that during prophase
calcium concentrates in the condensing chromosomes, and during telophase it is
transferred to nucleoli. These observations suggest that chromosomes may serve
as a reservoir of calcium during mitosis.

Publication Types:
Research Support, U.S. Gov't, P.H.S.

PMID: 6491256 [PubMed /​ indexed for MEDLINE]

497: Mutat Res. 1984 Jul;127(2):119/​22.

Chromosomal aberrations and SCEs in Allium cepa root/​tip cells treated with
caffeine and pyronin Y.

Cortes F, Hazen MJ.

The effectiveness of caffeine and pyronin Y in the induction of both chromosomal
aberrations and sister/​chromatid exchanges (SCEs) in root meristematic cells of
A. cepa was studied. The rate of SCEs proved to be increased when
5/​bromo/​2'/​deoxyuridine/​ (BrdU) substituted chromosomes were allowed to
replicate in thymidine (dT) for a second S period simultaneously with caffeine
or pyronin Y. In contrast, only caffeine was able to induce aberrations in
BrdU/​substituted chromosomes, while pyronin Y seemed to be ineffective at the
doses employed.

PMID: 6749158 [PubMed /​ indexed for MEDLINE]

498: Tsitol Genet. 1984 Jul/​Aug;18(4):318/​9.

[Cytogenetic activity of the herbicide sodium trichloroacetate]

[Article in Russian]

Kurinnyi AI.

It is established that sodium trichloracetate does not induce chromosomal
aberrations in bone marrow cells of mice, does not modify mutagenic effect
induced by rubomicin, but increases chromosome aberration frequency in the
culture of human peripheral lymphocytes and in germs of Crepis tectorum and
Allium cepa seeds.

Publication Types:
English Abstract

PMID: 6474569 [PubMed /​ indexed for MEDLINE]

499: Eur J Cell Biol. 1984 Jul;34(2):248/​53.

The relationship between the division plane and spindle geometry in Allium cells
treated with CIPC and griseofulvin: an anti/​tubulin study.

Clayton L, Lloyd CW.

Isopropyl N/​(3/​chlorophenyl)/​carbamate (CIPC), and griseofulvin, were used to
perturb mitosis and the subsequent plane of division in meristematic cells of
Allium cepa. The effects of these compounds on the microtubule organization
throughout the cell cycle were investigated by immunofluorescence techniques.
Microtubules were not disassembled by drug treatment, but the spindle
organization was disrupted, resulting in tripolar spindles which gave rise to
multiple nuclei. Ensuing cell plates, with associated phragmoplast microtubules,
were branched. The effects of these drugs with respect to MTOC duplication and
function in plant cells are discussed as is the relationship between the
pre/​prophase band (PPB) and the plane of cell division.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 6383831 [PubMed /​ indexed for MEDLINE]

500: Indian J Biochem Biophys. 1984 Jun;21(3):214/​6.

Effects of allylpropyl disulphide isolated from Allium cepa Linn on high/​fat fed
rats.

Wilcox BF, Joseph PK, Augusti KT.

Publication Types:
Research Support, Non/​U.S. Gov't

PMID: 6519679 [PubMed /​ indexed for MEDLINE]


 

Go to Previous Page
 
Go To Top
 
 

 

 

HOME | TESTIMONIALS | INGREDIENTS | PHYTO PROFILE | RESULTS | AYURVEDA | FAQ | GUARANTEE | ORDER NOW! | WEBMASTERS | DISTRIBUTOR | NEWSLETTER | VIDEO | ABOUT US | CONTACT
These statements have not been evaluated by the Food and Drug Administration. This product is not intended to diagnose, treat, cure, or prevent any disease. The information provided on this website and in emails is for educational purposes only and is not intended as a substitute for advice from your physician or other health care professional. You should not use the information on this website and emails to diagnose or treat any health problems or illnesses without first consulting with your doctor. You should consult with a healthcare professional before starting any diet, exercise or supplementation program, before taking any medication, or if you have or suspect you might have a health problem.

Copyright © 2002-2011, India Herbs. All Rights Reserved.


Doctor Endorsed
Click to verify BBB accreditation and to see a BBB report.
BBB A+ RATED
Halal Singapore

Refered by: ziacorse


Multi-currency display